ELF4 4 (444v v v $6Cw ((( Qtd/lib/ld-linux.so.2GNUC_X5EU^IV97L#P:< %,6\T/H]RDA1Z!SW-KCB@[YJF";*+  ()'2 .?8=0$3N&M>OG4Q<&tRg6Cq$Yb%I(B};:26W =$=,AFeh(=!F(=QScYGX +2?"+b-,=!F kkq70[4;2j,%4Z7V`6c" Y. ,=44g&& &q|L: [ libm.so.6sqrtfloorcossinpowtan_Jv_RegisterClasses__gmon_start__libc.so.6longjmpstrcpyasctimemkstemp64__strtod_internalstdoutvsprintfreaddir64ungetcmemmovesnprintfgetenv__strtol_internalqsortmemcpyperrorreadlinkgetpasssystemmallocremove__strtoul_internalfflushputenvabortpipestrrchrstrcatfseekwaitstrstrstrncmpstrncpyprogram_invocation_short_namerealloc_IO_getcforksscanffread__xstat64localtimememsetftellsrandopendir__assert_failstrcmpdupgetcwdgetpwnamfgetcfclosestderr__lxstat64fputc__ctype_b_locfwriteaccessrewind__errno_location_IO_putc_setjmp__ctype_toupper_loc_IO_stdin_used_exitstrspn__libc_start_mainstrlenprogram_invocation_namestrchrfputsexecvpclosedirvfprintffreefopen64__progname_full__prognameGLIBC_2.0GLIBC_2.3GLIBC_2.1GLIBC_2.2 ii Iii $ii .ii 8ii ] =$= (=',=S      $(,048<@DHLPTX!\"`#d$h&l(p)t*x+|,-./012345689:;<=>?@ABCDEFGHIJKLM N O P Q T U V W Y$ Z( [, \0 ]4 ^U{5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@% hX0%h` %hh%hp%hx% h%$h%(h%,h%0h%4h%8h%<hp%@h`%DhP%Hh@%Lh0%Ph %Th%Xh%\h%`h%dh%hh%lh%ph %th(%xh0%|h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h%h%hp%h`%hP%h@%h0%h %h%h%h%h%h%h%h%h %h(%h0%h8p% h@`% hHP% hP@% hX0% h` % hh% hp% hx% h%$ h%( h%, h%0 h%4 h1^PTRh, h@- QVhPOGUS[q tX[ÐU=0=t H ҡH u0=ÐUtt $ÐU@=]Ðt&UVSÃtNsLt$$Ct$$$$u[^]Í'UE]뇍&UW1VSà ҉U~/?1EC E}DP|tF9uu߃ [^_]ÀAw E|߿ލt&'UWVS1 uE1EE1 t<1  S t$T$4$"u1 [^_]ËE4$D$tًE1 t\$4$tƋEGEHH1 En1멐t&UWVS? EU)EEEEE5 t6$*9EErߋMߋu9uЋUEMЉ[^_]Ã1[^_]Ð&U(uƉ]}tE$E1]u}]Í\C މuڍ}ڋu#9tqE)~ At|Otw~ 8E~^8T@~Z~;1)ƃt" )ƅt&~ډuSEPU뺅벀xEt&{E뙀xtrxhhEuxhPuxouxruxnuEJ&'UWVS,EE$T.$,@@@L@PEEt$$0$U$ƍC)E{u?F$N$UUt$$T$U0E,[^_]É<$$zUBU$T$뚍vEE$]$PÉU$)UBfsc@C$$]Uۉ~/1ۉljUE 0DPt C9]u܋UU&E1ts1 <$EE$1 ƋE)ƅ$z@$$QUB\$$gqE$GH1 ۉEtH11 GHt1$9E܉vM܋E\$)Љ$NuɅ-U$E@$L$UB|$$'UWVS Et8.D$E$})Cw}?utJ1 [^_]ÍCuߋu. uˋEXӋDPuNA1븍CH~;0ETDFu AzA9u݃ [^_]Ë}<$A&'U(}}u]<$u]u}]É<$nv .nG.tPtL1EMDAA7ZB4t.u14$-at$$/ ?t$$0 %wP0$/ b|$D$$/ D U1S]t$@\$$`=D$i[]Í&'U.WVS,uD$4$EtE9EEETn_U9UK$‰MU AM<$$uF;u'_D$4$9EtM9vEE])C$$#\$t$lj$ <$uA<$x^U;E{FME 1ɋD A9M%wM9M~=UM U'E>E9Eu؉<$p$`EE,[^_]ËP =wvt==@=~!@tD$ |$$ . D$$Ɖ=@=o|$$`0 Z=y=cU$80 T$fEE,[^_]É4$tEyUWVS,E\E Qu.D$4$UEE9EMEEW$‰_UT$U $T$*ƅu<$$uF;u_|$4$9EMtE9EvUU])C$$V\$t$lj$<<$t`n_7_tB1UT$U $T$;)ƀ;uԅE<$tpxtIF ED$U T$D$(EC9FP =v=t==@=~!@tD$ |$$ . D$$Ɖ D@=|$$`0 T5 D$ D$0 D$$". EEEtUEE,[^_]ËU$80 T$n]tۋEU@E,[^_]Í=4$]E(v'Ux]]u}u]u}]ú#T$$xQtǡ@=1'\$D$$ÉE$}<$4t$z]t;#t9v;D$$Et9tD$<$t$<$ztE8;D$$<. $$'$)' @=$ O\$$4. :D$$<. @Et$<$yM9v,A<v0 vD$$0 C11D$ D$E $D$bt$<$DECEyM9v,0< AtۉƋE ^FP~1ҋDD B9|󋅠$$`=D$D$lau vЋPLupL=@=FD$ $j. D$D$~~pD$$. C9F~QD=݉D$$. ۃ$R. ƋE FFP$?bY$$$~. D$D$;t$ $$`=D$D$[YUЗL$$`=aÍvU$`=.^1D$$. D$$. x31D$$. xø. D$$0 趿Ít&. D$$0 蛿붉'U(}}]uu .D$E$U$j4$`)ÅFEC$$#U\$T$lj$f~uDE ]u}]ûe5 e0 \$ L$T$$. t&U$@$<$U U$T$듋E$@$ $rUT$lj$X<$1$JU U$BT$]5US$]t.$2D$E\$ T$$t1$[]À}Bu1}Mt&'UWVSEȉ$艕U $u D$D$E$t$ t $x5 i}Bu}Mt$5 Q[^_]ÐEMUEх~EUM|E{U~E}UE‹E 4^\$D$ E|$$G9(EMUEEUMMEEU]JfEfUMU0EEхۉ(,4{|~}f0$f0tf0tf0 $E)PЙ,0UԉNjU̅EЅ$@-$b&f0 $-7 R8$77 D8t$D$ 4$^D]̋0Ӄ$T$u 4$d(\1tؾЃ))ƋUЋ$$b<ËEЅ<1F9uE |$$D$ D$9t$`6 $:<$$xEUEUUEUUJfE1۹fU(,к04tt&|$ EЉT$$(6 D$5[^_]Ðt&f0EE1@$$É8$t&EFECEC9iU T$ U,$D$D$#;,t$7 w84$$ ۉ,1]Љ4Y((fMЋ$$uЉlr$7 衯$7 蓯v똅tOCfEvRKf9qvEf94 w1@f;EuD$X7 @1)֍D>#UWVS ]} uCPuHCtA[<r4<$$;  [^_]Ð1Ƀ [^_]Ít&CD9f{V11CHDwATwFf9Kw߃ [L6^_]CD@9f{1 CD9CD9CDD9Ff9swȃ [^_]$8 Ҩ=C9f{11ɍt&'CDDCDCDDCDDFAf9sw $8 EW$8 4w$8 Zt&UWVSUE BPE]C`Ep%t#H$W; >x?1[^_]ÐFtV]8t1 ]:te@f9u뼋F FN t]:1]8@f9ux$8 '=@]>vOFЄU6F1}EE}E f9w B9E~RfBUDECf;]uBD$E$[^_]$;; yU)f9]D@$9 M&UWVS ]} CP7K,}[CG%C9E{11ɐt&CD9BAfCf9wM;ECUD@9ECU@{t{11C GAC DAC DAFfCf9wŋU [^D_]ÍvHtY$p; E;E\ [^_]Í 1[^_]$H9 ڤI$H9 ɤCD9E|o{t]11'CDwCDDwAFfCf9wэt6u[$H9 YBE>$H9 <냍v'U}]] uu $;  FFCCCF]u]Ít&US]tBt<t$EX[]t&Ct$$Ѝ&[[]ÍUS]t9<ts*Ct$$$EX[]<uX[] US]th%t'Ht$$W; ;x/$:EX[]'Ct$ $;yыC tʉ$$X[]ÍUS]tBCt$$Ct$$$EZ[]X[]ÍUS]t Ct$C@C@CY[]$; ҍt&UW1VS ҉E~$1ۍv'EC$t 9ލ<u [^_]Í&'UWVSEx U1BPu[^_]Í1; t$\$B $%U}Ef fEm]mJ4EȉD$BD$$$PNjEx @D$ t7<<$G$7$: [^_]ÍUB$$/f>C(td1.T]K(M$D$(UGf9>v2F ^D)Ѕ]C(Gf9>wΉ4$4$[^_]$9 jt&UWVS,}GPO(G>$$XE>G,dEG,EG>;EA]G(tֺI< T$$ t1D$I< D$G($}Ef fEm]mE~I< L$t$G($}Ef fEm]mW4EЉD$GD$!E$$^ƋGDD$ UD$4$T$;Et $Q< UG,4$ÍD$&4$+$EEEG>;E'E܃,[^_]G>$U$G,I< D$G $uG,EE܃,[^_]1D$I< D$G $}Ef fEm]mu~I< L$\$G $Q}Ef fEm]mW4EЉD$GD$U$$ƋGDD$ E4$D$D$V;Et $Q< 荗U_,4$D$x%4$$EE<$&'UWVSuFPt F(v~,7^9F>$$&FPF0)E~>1EF0E8F>;EF,8tٺe< T$$tĸD$I< D$F(8$}Ef fE1m]m]D$e< D$F,8$}Ef fEm]mEËF4É\$FD$N04$F0$EEF>;E#vE[^_]Ðt&F,te< T$$uF0EE[^_]øD$I< D$F $}Ef fE1m]m]D$e< D$F,$}Ef fEm]mE~4\$FD$^04$F0E[^_]4$yN4F8ȉD$FD$4$F4$}UWVS $ K$UNjBD$؅fuGGG [^_]ËMAD$ʀGwxC$$Kۉ]G~91 GMWËADF;u|؋G8n$9 ]$< 诓wv'U8uu]}F k< D$F $u"NP FEE]u}]1k< |$\$F $}Ef fEm]mEtu(NPFE$; ߒWN4ȉD$FD$$z$FE܋FD$AUfB<NvFu}EM ?PCۉUЉ}f $AMuЋ} ȉ<$+UM\A$\$$2$u}F\8E $D$U $T$跳E<؉[^_]Ëu}F<}} $; W&$C@vt&'UE]u}x@LW t)΍F$$)ËEPLGWt$$HD$3]u}]ÉU(E ]Uu}f=wI4H 4$ݱÍ@$H$谾\$t$lj$薲]u}]Åu1R҉Ut-ЋEf9v@4<0\0)C$۾$CU\$NjBr<$HD$躰낍UWVS } ]<$Ct$$ e$ͽCf@$C$諽F<$谰@C<$褰$$|FÉ<$臰|$$D$<$o [^_]$9 Kt&'U(}}]]uu f?u0K~fEE]u}]Ív$; 贇Ӊ<$EG9]EFEH=wHG11FGD1BAf9sLGHD$G $D$b=wPG11FGD^GD^ACf9s֍L^$; L=wIG1FGDAGAGACf9s˃7G11FGDDGDDGDGDCAf9sL&UVSut$_$OFt$XF t$Ft$:Ft$+Ft$Ft$-F t$F$t$F(tJ~> V(1ۉ't $!V(CfF>f9wމ$薺$膯F,tI~>V,1ې&t $V,CfF>f9wމ$F$6F0tI~>tV01ۍt $!V0CfF>f9wމ$$F@t$4$׹E[^][^]ËV(V,dV0믍'UWVS$T$cEFFHFPFLEFFFFDE F F$F(F4F,F0fF<F>F@D$FD$茻FD$AFFD$3FFD$%FFD$ʀFwKVw~tLF< L$$: D$ ‰D$X4$1[^_]Ít&$< 막V4FЉD$FD$غ4$H9EV4$4$H9EWM_D HD$ J$F <$< D$F $< D$F $34$1CFFD$5} < )F8L$\$F $e}Ef fEm]mV4EЉD$FD$ƹFD$kfF<< D$F $NPjkD$F $NPk< |$F $NP F8V4ЉD$FD$@[^_]Í1D$< D$F $H z$: 54$1NP@$< )1۹k< \$L$F $}Ef fEm]mE. NP1D$jkD$F $}Ef fEm]mEHNP< D$$@: I4$1$: .4$1$h: v^NP@kUWVSEXE@EUE9BE}HʋB~׋DR uB U }$Ef fEm]mED$UËBt8 E \$$P$$o$_UEE9B`t&[^_]ËB U }$Ef fEm]mED$UËBt8 E \$$kP$$$רUBD8 @}Ef fEm]mED$E $UËBt8 UVS]tmCtPs~fS1&'D t$K$;SF9sډ$2$"$"E[^] [^]ËSΐ&UWVS Ex~R1t&'M t9EPӋCD$E $uC F9u 1[^_]à [^_]Ít&UWVS E@~v1t&'E tYUBËCD$E $耣u4C Ct$$U1ۋB\8 v'EF9p [^_] UWVS,EUE} E]؉Ut^tZ@EU1Z F9ut^C<$D$ТuE9C~`C UEЋE9pt/,[^_]ø(T D$N T$ D$$O }E < EN ,[^_]{< D$$O {1두UWVS먐U]ÍUS]$n$k `GX[]ÍUSÃ@tCt$$ҖCPt$ȡ$踖C$赡$襖$襡$蕖Z[]É'USdG]t7x dG;|BT \$L$$JT ldG@[]øBT D$$hW k USdGtBT D$$\T k$ _$Ǡ@$@dG=$襠CdG[]ÐU$0$v@@@ @@@ @@@$@(@,ÐUEt@Ƀøws D$W T$ D$$輑t&UUtE Bøs W D$ ID$L$$v&'UWVEta@PuT :t%ֿeb18^_]vT :BuwT :BuxT :Bt밸s D$ >D$W D$$ѐ'UWVS]twStY{1ۋ7q 4$D$&tH u1[^_]Ðt&Gq $T$u͸ӸBT D$$yT ;i됾s -W t$ \$L$$Uuu]]tHvBT D$$T hDxBT D$$W gE D]u]øs D$ D$W D$$蓏t&'Uuu]] t(vBT T$$T PhD]u]þt W t$ \$L$$#t&'UEt@øt D$ D$W D$$ߎ&UEt@ @ø-t D$ D$W D$$蜎t&UEt@ øCt W D$ L$T$$_&UEtP 1tBøWt D$ D$W D$$&'UEtømt D$W T$ D$$Ѝ&UEt@øt W D$ D$L$$菍&US]t5C$tC$E[]C($C$C$E[]s D$ D$W D$$US]C C$tBT D$$T eC(tBT D$$T eK,tBT T$$T eCt$֚$ƏCt$迚$诏t$詚$虏CtCt$茚$|CPt$r$bC$_$OC t[]F[]É$$Cdvt&'UWVS|5dG$]$řUEB8MA B4ABA]E[0Eۉ]%p I1Fp 5$j\$D$NjE$襌uϋ4p u$ 賙$U҉q UE$@$胙$M\$$q $@$S$軘UB\$$юMY0$賋9]UMZq A]x]UMۍBq 9A]UMCFUCT$$buۋS MB ;A u͋B;AuŋB;AAEJSMЉUԋ$T$uUԋMЋBQ$T$n{ uEЋMԋPA9}ЋUԉB}tY9>~UM [T$$賈uC] S$T$蚈t"E$X D$BT D$a5dG69uE}E|[^_]É$A5dG$ R$躖U ËEX$轉@$,$蔖M D$]C$行U EXB$}@$$TM CAD$]C@$^M SAB$ 詖$ENjEX0-D$$-exp[-L$4$fPUx]芋MDP$诈4$襈)É؉$[$vMQ0\$$T$V4$hËE$[)É؉$[ĕ$,Gt$\$$G1D$ D$1D$U$z5q G1Eq HEeq tT$$ uЋGt$$u p\$BT \$$W <_EX0EBT \$T$$W _MY0UE؉T$ M L$]$\$16~5dGF9=]$@$t$ܓU؉B\$$$چ@$I$豓M؉\$$ȉ]؋EMC dGPE|[^_]Ã{ W]C D$AD$BT T$L$$$X D$ &]EBT T$$lX D$ ]BT \$D$$W ]EX0R11D$ D$;t$$YMAIXF^$ǒ\$$ے$蓒FED$ U \$T$M؉ $\]]\$ E D$UT$M؉ $f'5\$ ] \$ED$U؉$.E؅ o ɉMtJ11]̉\$E$St~U$M̉ $9tEo G ҉UuM؉ $lEEM5dGA\$]̉\$E$ՄuM1 $t $$I]E$St$ D$E$]\$U$>MA UHu]$,Bolf@d41o }]$D$ڃ<$É\$T)o 1ɉ]EȉL$$貃<$É\$,)Uȅ҉Et_t[]M؉YT I\$Eȉ$t $tNxs W L$ T$D$$X xs W D$ |$t$$T ԁT D$$;$$ƸT D$ $$ǸT D$$}Ef }fEm]m$ $wËE؉X4$@$$VU؉Z<$^@$͏$5Ct$M؋A$F|$]؋C@$1CUP U D$Mȉ $<t $tnxs W D$ |$t$$Y 芀U 4$D$ uM A<$D$ ]$X \$@Y$U ø މ{]C `G$ET g$= Y\$D$Eȉ$vU$;$DU -\$D$Mȉ $J$MU $= \$D$]ĉ$E$$Q \$D$Uĉ$M؋]ȋEċUY(A,BZE U;PM$(Y L$1W$\Y %Wt \$Eȉ$ltt L$Uȉ$u T$Mȉ $@u D$]ȉ$t U މ]C iU$U,Bol@dIta@licxs W D$ D$|$$1~E$fM,Ita@licU\$$+U VUS]tBC$t$C(C$t$C,C(t$wC,X[]ÍUVSdG1}tFC$t>hGC <D$BT D$$U #Vv$($$X$HhGu.dGF90~=@hGp$\U U_$u F|UdG90ƍv@$$dG$$1dG[^]Ë$|D$(U=hG CD$$aU UC t& hGukT$$et'$ t&hGuJ$?]D$$)u $I$=$fU oT$uU aT맍&'UShGÐUpG]Ðt&UE]tGÍvU]Ít&'UWVSdP \EE\$E M]EB $^61ۉƍ'dP \$L$G $(}E% fEmR m$C4$D$Pu$dP Uĉt$D$B,$M1҉T$ $$f$E1E&Ff9uUމ؉уtًMD ЋU<EztS$U$D$Eԉ$pE$D$Eԉ$VR }E% fEmm$FhUԉ$D$f9u: E$5$t Uĉ\$D$B($Mԉ $覽t/Eԉ$$t iUĉ\$D$B($Mԉ $\[^_]$t QD$Eĉ$+C$t Q2$v Q< UWVSL$UĉE谠UĉEB>$螠MĉEA>$茠]ĉEԸP D$C $P D$C $I< D$C $jkD$C $űUċ^8|$t$B $M@y>E1']1ҋC,t-t&8T$L$$CÉMԋ]ЋAs 8ʉT8Uĸ7D$8D$B($MEÉ\7A>;Ep]ȋuċC4$D$ E܋Ẻ$ڞËF$͞<F$连UĉƋBXB _@@ËB$$虞MЉ $茞M܍T1uԍ F4K$]&$莄\$D$E؋Eĉ$UĉËE)؉D$E؉D$B$&M̉ $É]]ƋE)D$ED$C$ƋE)D$ED$C$1ɺk< V$L$T$\$ C $E$)D$ED$肤1V$D$; D$\$ C $E$)D$ED$11V$D$< D$\$ C $C$$D$ED$C$$ƋC$u$W1C$D$A< D$E\$ C $?uЉ4$Ĝ}EFH$j$҂F{>11UԉJȋMċpA,)֋8tq~mME؉$t$ȉD$6U1V$D$I< D$\$ B($MĸD$I< D$E\$ A($qECPHD$UЋJȋMHD$A(8$uuF>9)EЉ$讛UD$EЋUЉD$$MЉ $]ԉ$ݩuFH$($萁VFD$JT$UċB $4$5}4$D$ED$4$u$9Ɖ$_4$$t WMȉ\$D$A,$q$t 5$ U '\$<$D$GE؋]4$D$\$14$YU؉$΀$uEL[^_]þI< t$uċF($!v'UWVS}OEP$@,$$MU rM\$D$A($UD$$1\$D$$vfL$ MAr1D$E$U$øD$Ɖ8t $t AJ11ۉht1ɀ8xhE1ۋ@Co$+r$$L$É$u$q-UTFf@16@\$<$}$~$s1D$<$(kD$<$WkX D$<$V|D$ d D$lGD$<$cxLEfz<11ɻC؋Lf9X<hуt΋LE\$$ttLD$ $˾tEED$ ED$ED$4$H~ UE4$}$r3LB$$L1ҋ|A$1ɍ9~BuET$ LS$ $p\$nU < $|$qLA0$֤LpB0 $|$qLU T$$LU D$$LL$A $.LD$@,$L $詤LD$< D$B $VLU D$ $菹LP1$D$< D$\$ B $L|$ $RLP$t$\$\$ B $1ɸL$ L1҉D$< T$D$A $LfP<‹EL $ǿ$ll4$@D$hD$d4$\$2u U\$D$B,$84$`[^_]É$ t$ h3t'gfffꋅ)91D$<$%É<$dtt$t$D$W xt$x $D$3 $ULB $D$ӻdP T$LB $ (z ݝ,z ݝ0z ݝLP D$B,$a 4z ݝLP t$A $s 11ɉ1TD$L$貴Lq$9 8z ݝL1Cz toD$L$bLq$9}ϋ^ E D$ L@0 D$D )ЉD$FJ$5Eݝ01 Clz toD$L$޳Lq$9}ϋ^ E D$ L@0D$D )ЉD$FJ$*5EݝZ 1 C\z toD$L$ZLq$9}ϋ^ E D$ L@0D$D )ЉD$FJ$4Eݝ݅LeQ D$A,$V LP D$B,$28 UBtu \$$iO ݅$薳$ u U\$D$B,$"݅$d$u ֽU\$D$B,$݅$2$u 褽U\$D$B,$݅$$P rU\$D$B,$݅$β$&u @U\$D$B,$ZW1$$虲$,u  M\$D$A,$%LP L$B,$1҉PTLP 1L$B,$1҉X\#hLBe$.ZE܋U@f9B"k<$E$f`U$蛅z D$ D$v D$$Hv'UWVS,E(,$$~, $4Z<,$趼,$8u D$e8<A$D$ A",D$B $D$40P$B z $$R }E% fEmmݝP1$Ed1`1\L$@ E@9`t4ۅ\$h4$D$`4$T$ 1L\`݅@$#D$`$ї]&'C9 t_T_ ‹$t (\$$D$4$B] u{0$S$H8$S$H< $S$qH4$kS$[H[^_]Ë`t&u L$, $af,$C4B z P$R }E% fEm۽xm担,u T$$&aEE,u D$$`ۭxEE@@]赎}EEE$@ t&]tUZ ËP |$$蜘 UB,P T$$s ]MA,tP \$$I ]EUB<E u1EEt&'Ѝ&'t EU@EIBuGF;}uEM]HEЍt Mԉ]$K$jJf@$J$KJCfC@}_ $J$"J|UfP4$J$J|AE؅xZ}11G}&ً}ƒ))tt|Bf\pFC9]uMQ |YD$Q D$A $ʙE@P1$D$Q D$\$ }G $~$I$*IG(01ۉt$A< D$G($]UB<$D$xQ P$L$\$1\$ G($I< T$D$G($1D$I< D$\$ G($轖1D$I< D$\$ G($蛖t$jkD$G $螘A< L$\$1\$ G $^; T$D$G $a1D$; D$\$ G $!P D$G $mP D$G $YI< D$G $Et$G $6< L$\$G $螖}Ef fEm]mW4EЉD$GD$I<$w}EGD$a9EEf8E@$JaE$G$GUB$G$Fu؅EM11EEAM;E&MGQMUMBUHD$UBD$+IMAD\$D$ D$E$81D$(E\$ E\$UB0D$B\$ D$ML$E)D$]Kȉ$<NjE@EF;u]1ƒ))t̋UEZ؋X)ˁt$$v g;EUMB$EML$$E$ZEUBU]&_}f9}t $+v E$?E$/:U$B,$q$MU 3\$D$MA($M]$貟t Ĝ[^_]É$転u tGh1D$E$$g$E D$M$Eu4$SE1D$M $Nx ]{t $u  ku |$u4$MUB @\$D$M $YER]CPQ t$uF $ŋ_E$u$?$>1҉E܉\$1ۉT$$3U؀ EEt&Cً}ؾƒ))tÉED$U$2]MCD$E$y D$ xtG@@$D$Yz$t ˄\$D$UB($E$jU܉$w=$g2M $]$IFuuĜ[^_]tkt&u܉^T^E@EċEED$M $8]S(D$uЉ4$M܋EE$轟SE< $eU$kM $l]$p1D$|$C $菋}Ef fEm]ms4ED$CD$>$hrECD$R.u6Efu$1<$;Ef@E$u<$;UB$[<$;EMf@M $6<$;]CE@$UE$ <$r;uF$;$X;EEEEEE@E1E;EMEQM@UBUHD$MAD$=]CDt$D$ D$E$Q-U$T$jUT$ 1D$(\$MA0D$At$ D$ut$Eu)D$UEJȉ$z~EtuVFfCt[11ۋUB0tt$h`MA0UB,tte< |$$詅MFA>9UEOu4$|E$@U$f=pG~\$ M̉L$]$hv \$5$smƋE@D$E؉4$D${4$$2u ~\$D$UB,$uĜ[^_]ށ1۹Q \$L$F $D}Ef fEm]mEd$Yv /$u D$U$2$t !]$y D$kCU$y D$Q?$u @$v /$y 5z v \$ L$T$$'U|G]Ðt&UE]xGÍvUȉ1Ґ& f9tf9 ‚ tB u]‚ ]Ðt&U]Ít&'UWVS,EtEtx|$E $EwU$IEMUBt\=HeM $I>E$~c,[^_]ø D$ D${ D$$t &MAD$E$uD$U$D<$R5$4ǸD$|$M $z~Z1EC9~(:uN)CD$BD$$&E9؋E~|$M${ L$%7E EE<$D$'/9'|$ދU)${ T$9<$&$Y4$3E܉|$$)<$3$(MYI U܋EP@ $ 3$e3MÉAEp]M$T$$uMFQ$T$$tg$ | EPBD$ BD$$u D$rUBD$ BD$$u D$O$4| MqUF;BMY$%@$3$}2UBD$MA$(UEXB@$`%@$2$72MCA@D$UB@$>(MQMA@BmUB($ET -y$= y\$D$MA($9$U x$ U x\$D$UB($ 1҉T$ MAD$ȃD$E$ UB,MAU܉$x$Q x\$D$MA,$蚄E܉$_x$DU Qx\$D$UB($kM $:E$5_,1[^_]EU ҉UE $y D$UBMA xHE܉$#U,Bolf@dUBqE܉$c#@D$U܉ЃT$$"M܉ $LE@+D$1D$<$<%D$E <$D$D%<$"JU1RM $,{ L$1M:U$"@$$0$/MD$UB$%UMBY$u"@$/$L/MCAD$UB@$V%MQMABU܉$'"},Ita@lico$`| $| MUqBF.M܉ $!u,Bol@dIta@lic${ g$T{ V$Xy E $.$\.UBAdobf@eZ$ .$/.MCA@@Iden@tityA@t$U $E]MAD$E$@ESM $\v'U҉SÃTtdEEEEȉEEUUE ED$ED$ ED$T$$52EuEt6t=t 1ɃT[]EUM U אMȃT[]ME 뻐t&UWVS,EP$t>@,$/$MU s\$D$MA($ }<$pt ,[^_],hƋG$$D$qu$T s\$4$D$GX$M$D$9u$T [s\$4$D${G@$h$T /s\$4$D$O$T st$D$G($0<$踎u xGv|$U$!44<$@ N A=NH}1ۋ$ D$\$ $:MU Y3;11ۍ'B D$@ D$ $"$5G uŋU$<} D$MQBD$$p} D$a$} 510UB@ɉLHt t x ~ $ HuT :u"vT :BuHwT :AD E1@DUċ24$L $ËH$DЉ$*$)t$HT$ ø LD$$L$$*D$^)$ND@E@:H1D$L$} T$$} D t-D$ FHL$L$ |$0u$,~ $ SD$ 1,Z11D$U$虊x$$蟷1ۉt$M $cx$$i "tu"Htԋtƍ((t/1ɐu(AH(uf(u1b(HIu1ۉ|$t$$|~ t$\$$sJFf9(уtы,u D$Nj$ $ 0x9N\$$$ E.\$|$$P~ )](@@$D$b$t Nm\$D$G($kyj Y' ,18 (v8tED$8$\t&t$ED$ $HfEt:Ff;(Ӄ:tϋt:u,fu䉵<9<D$$$8fET$<$P~ L$t&MI(t^WcOf9<B@P$ z  $$R }E% fEmmݝ`(11(l1hwpE\ vC9ًƒ):)tÉD$$<tt)WDP$G z $$R }E% fEmmݝP݅`݅Pu]z[h)ۅl$\D$$ybhT$ $ab11҉h\E@9ht:ۅl$h\D$<$bh<$D$b1\[lh݅P$\D$h$a]C9Xhۅl$[D$$ahL$<$ya݅`$[$t f\$D$t$7r$)}$t e\$D$t $r<$'iE@(EB R )P$ z A$$R }E% fEmmA ]$$A z $$R }E% fEmm]1BZ(Ew C9<ًƒ):)tÉD$$_9tt)‹ADP$A z $$R }E% fEmmA]D$$ R A z $$R }E% fEm۽xmyB RЉ$$ z R }E% fEmm]EEuzEEzS$U$XD$$^E$XD$$^uE$XD$$o^ۭx$XD$$O^E$XD$$2^EL$ <$N9m$~ J\@z Eu4z2E z z uM<$e^WE$W$D$]uE$W$D$x]$u ,b\$D$E$In눋 $#4<$ I*sU  11҉$10 ,0}G @D$ $$ D$HV * * % 8|$\$ L$T$$]b % * * L$ T$D$8<$L$t]t$M$q4TUB @D$4 $, }E% fEmR$ z  $$R mݝ`xT :A11ɉ ,f61([h6 U1ۋB Hc$| D$GLU$ } D$-L$v$u |_\$D$M $k$t2U$ D$U$H D$$ vw, D$ * D$* |$D$8$`, * * |$ t$\$8 $mJ$~ ,݅`$ T$t {^\$D$t$j\P}}$| D$$~ 8$O18UG]Ðt&U1}]GÍ'USG]t.x G;|\$$ /G@[]ø D$$$  뻍&UVS1ۃu Et#3tD3 u'4$$ [^]þ D t$ \$L$$ UWVS }t$$ G tCt$$ G Pt$w$g G $d$T Gt$M$= G t_$t2Cst$$ $ $ uЉ<$E [^_] [^_]ÐUSGtW~"1ې&@C$G9@$$ G$$x 1GX[]Ðt&UWVSE}P҉U~gXEvE E9EtJ9;u~NM s:w܋SU1ҋM:sˋM  :2wM: rB9u1[^_]Ã[^_]u却&* D t$ \$L$$q a'UUtE Bød D$ D$D D$$q t&UUtE Bøs D$ D$D D$$q t&UEt@ ø D D$ L$T$$q &UEt@ø D$ |D$D D$$q _&UEt@øu D$D T$ D$$q &UEtø D D$ nD$L$$q &UEU tQt;~>t"t D$T$$l 1Ë@8Í&@0Åu΋@,ɍvøڈ D$ D$D D$$q P&U(E]u}tL 8u]ȋu}]ù  18Ի D \$ L$T$$q &U(}lj]uUtxp$tqxmE=}Nȋ]u}]É$ $|$$fs_$C뤍v D D$ |$t$$ 'U$$1ҍt&1ɉL1L uUVS$<\$@@@@ @,@0@4@8@(@@ $x$[C C$ $=C$@$$F[^]Ít&'UWVSEUA~ZE4uS1M-U؋2;}D t&U\G4uF udF 1[^_]$ X[^_]øه D$ D$D D$$  t&Uuu]}tzttFxmhV~atF tVFtA4$NjF$Ë$D$0u4GS$T$u &1]u}]ÐF$E4$;\$$ D$W1ōvUWVS }<$5G~j1t&5GC9~U<$ơG@$4$D$buƻ t$\$$؄  [^_]ËV9~1BF< [^_]þ t$$3 kRFZ^$ \$$ $n F5G뜍vU(EE]Ӊu}M~2E~+t't#} tM֋}I9t,$ ]u}]ÉUMD:DwϋEU\$D$$yxMEUL$D$$\xEM;H,}H,MU;Q0~Q0EU;P4}P4M1U;Q8nQ8ft&UWVS,}Eu ]fE:ET$D$$MEy ,[^_]ËE@ UًB EEx̋E|؍PU@9/t& Gf}tkEGU@fE9|vEËuȋET0ECET0EET0EBf}ut&$E $뇉$ m,1[^_]UB LJ D t$ \$L$$q &'UEU D$ET$T$D$ E$EÍvUWVS,}Eu ]fE$ET$D$$MEy ,[^_]ËE@ UًB EE+x̋E|؍PU@9 Gt~UG9|`Eu܋EGCET0T0EET0EBU9}',1[^_]Í$\ dqJUB t& 9D t$ \$L$$q  t&UEU D$ET$T$D$ E$eÍvUWVSLEu ]rED$U$T$MEhyL[^_]Í&MA MA ىEExōPUxE؍HM@9UEDEĉUEȍvEtU;S~UE;CEML0DL$U$T$MM)M‹EDT~/}t)MEʋ\@Ix=t&'UG9NL1[^_]_UB D$ gD$D D$$q %'UEU D$ET$T$D$ED$ E$Í'UWVSE@E5E@EUErv}9~Dž~'N1҉ME  E8r'F: wB9u$ n[^_]ÐE 8wF: vE U9UuUM;J,EU;P0MAQ@9UEJ@EˋM UCEUCCT$M$L$UCT$M $L$E@1[^_]ÿ D |$ t$\$$[ ]MP0AQ@9QEJ,U;P0+ՋAZ Y[$c\$$w$/UJBM&'UWVSE} n9}8<$t&Ut7$t$$UB t:t4pt-_ $D$ueC4$D$uRt&G~811ېt&GF ‹D$ BD$BUD$$69wыEx[^_]É<$ËE$\$ $@ D$ D$| T$$3  t$ \$D$$ E L$$ D$ D$`? D$ D$D D$$q %U܋BD$$p G$ ;fU܋Mԃ.E؋R M8UMEIM EEEU9~Ѕ~mMq8r`Y1:sU9:1w:t&rA9u'9MtEE E9EuU܋J,U؍)MMԉE,[^_]1Nj f"f D$$O tE܋H0~@1ۋ~9~C 9]u냉'UWVS,U EMUUEEMMU܉EE M؋HvEH "U:5EFEu FE;}K uurUBEEHhUM܃9MUfU܃EM*),[^_]Et#7Ht&L D$$ԃ EMU)1,[^_]ËUBI$ v1u؍E E E( ,[^_]$L 1M $$ D$$ǃ $ 9us#E1)ƋUC$& D$z9u$1bjM܋EUM MEE,[^_] D$$ tt&$l nU܋K9 |DECL$$D$TUM܋C) T$$؆  D$$O 뽸 D$$O  UWVSE}utjE tcEt\tt{1ۅ ~(ECt$|$D$ E D$E$u҃[^_]Ðt&Έ cD t$ \$L$$ !Έ D$ dD$D D$$ 1럐U(]É}׉up)9x |)C~9|N1C7]u}]Í@$WT$$${ C뭍S )9Xt$D$C$C‹CS|$$D$ D$9t $ {){Q뤾 _ t$ \$L$$ U$]Éu։}‰y؋u]}]ËC$D$Et։$t$$ۅt<$$E$RU(]Éu}׋@M$D$+ƸtHC$D$4$?u $2t"4$$]u}]É4$3$E(9EuƋE;E 4$U<$T$D$$UT$D$E$4$j$bEU1{4$KiUWVSӃ,ɉEM7EE<$Vɉ D$$` 4$<$EU9UC$D$C$D$4$d<$S<$E<$E4$E4$UT$UT$ UD$T$E$'ɉ D$$8  4$,[^_]Ã,[Չ ^_]'UWVSLɉ1ɉ}lET$$q>B$D$E$of$XEHq)ËsW4$t4$Fɉ D$$ 荼4$p.OB$D$j&$u4$4$q\$D$ T$D$$uɉ D$$`  $95 $"$q\$D$ET$D$ D$$qɉ D$$8 GI b?$,L[^_]ÁL[^_]$߉ t&'UWVS,ɉ1*ɉ D$$` ŹG$;}D$E$qxnF4$D$WtY$v$h=xD$ED$ D$qD$$C,[^_]É ,[^_]ÐUWVSӃ,ɉEME4ɉ D$$` 詸4$<$UE9U~C$D$WC$D$>tn4$py<$_h<$>=Eg4$hE4$-UT$ UD$T$E$14$,[^_]Ã,[ ^_]UWVSLEu 4$$$$$f1B rBZB|$B)$+$$$ <$v$$<$z<$ux<$_$I<$3! $G <$~ &'<$,G<$D$o$@ $}B$D$$F$5nv' ) $G<$D$$uSx$D$E$:t&<$2 }KB$D$$FS $ }<$D$nT $ EEE$wG<$D$bt?$$y$8 qu$1Mv1$@$/t$$G<$D$!$$l$f$T IB$D$D.$nj$ $0Et$'$E$$ $<$Q &A $ Bt$$<$}$mx E$ L[^_]É<$P CChB$D$$ $$<$S 71ۍe+t&ECU|$t$D$ $U9E$T$y&@  |$ t$\$$ <$y i#1e.t&ɉ D$$` 苯F$r9}fND$E$$B$D$$=d$=fUD$E|$$D$ D$::<$ k*1=ɉ D$$` {4$c<$[9C+B$D$ G<$D$4$%\<$J<$=F4$4$\$T$ D$E$qS$}<$D$<$ { EG\Ċ $9 E<$Њ  Eފ $ E$ƸT 6B$D$$BuS<$IE1$> $SmE1҉qU} E1D$E$%$#Nwi]$# ƸT B$D$$suSQ1$E>$Kz<$h}g =b$K EE<$'$$_D$E$ uSt$ E1a  p4$=}1ۉ1Ux]]u}t>$5@D$D$E\$ E$@t$]u}]Ëu Eu̸ 1D$E$u밐UWVS1ہ|EUԉ1ɉ] C;Ce ]ԉD$$T$ً! t€uҋ])L$MԉL$$R"U R$D$)‰T$8"] C D$u D$E$"1 Љ‹uwt7D$ D$$/ cd$L D$軧B UM] BL$$\$딃4cw]ԅe L$$T$ً! t€҃)ىL$M\$ $ U RD$)‹ET$$r U MBu  D$T$ $M 1$D$ D$Rً! t€,ҋU)ىL$\$$M 1Y'U B<@BE~51'M A\$D$F$OG9uuڋU B\$D$$)GM A>@ @<AE~11'U B\$D$F$F9uuڋU B\$D$$FU B>@ @<BO~31&'M A\$D$G0F$RF9w݋U B>P@ M 9Q)‰T$UD$$8M ]A T$D$$|[^_]ú T$$ MWBX*utHU B<@uBx+1ZM A\$D$F$0E9u}ڋM A>@ @<A[~41YU B\$D$A0F$D9pыU B>@ BNQA;BKD1)IZω9҉uX @ @<E~&1ۍ}E|$D$FC$e?9E >@ EEEU9P\EUMD$)‰T$ $QEED$ D$E$.UZ ME1҉D$$L$Md\$e ]ȉD$$ً! t€uE҃)ىL$$\$EUD$)‰T$U$xM D$u D$ $[EEE> |$t$$8U$$E$$MA$O$ D$m$ol$ \$D$E$$/P$$ $2 lM\$ $D$$EX x}L RD$$L 踛g$ cU1ɉL$B$t0MA$hT$ \$$ D$kn$ JU(ɉ]]uΉ}׉Et{f=wZk9~D$ ' \$D$$ ND)؉ VЋUH]u}]Íf=kv 뛉k둸' D$$̍ 蓚k&'UWVS7GոG5' t$$ PG/ 71۹?G G@GGBJ7G GGGGXGz$ѵ7G{Gg/^7ŸGG@GJG5PH7GGGGGZG}Ef fEm]mM܅x A9)հG;t&7l ' D$$s Ċ5l 7uGtGGGGGUԣGEGG؍QNQG.ِ&bؙ҉U)1E9G~EGBX9F9uGuU18l 11ңG1E G11ɣG1}}]裤G1E(GE G]]]‹Euu0 GMD$ED$EÍE$tGuE^E]u)}]EG^UVS 0ޅt[CC  ɉD$ 5 D$ =$\$$ 5 \$\$\$ Gt Vu0[^]É'UVS ut$tD$4$үtt  u1ۃ[^]ÐUE#Eg@@ܺ@ vT2@@T] U1҉H]ÉЉ}}C~]}]Í'U1WVS u] F D0@=u1ɍ1E9Au1һL3 T;Й%)ЉDD3CLu̺1T$<$D$=, [^_]UWVSEMUEE MM} MMIMt`Љ։E܍vEM@%EE M%EшUыM%2FA9u܉MuEUMH@[^_];t&'UWVS\Ep8M@Y @EEL$T$$EUMNjE11!1؍8xj׋}!1ʋ}V]]1]!1}̍p $1Ӎ !1Í3νu 1!1֍|E43‰1!1}ԍ*ƇG1!1ڍ F0Mˉ1!1}F 1Ӎ !1Í3ؘiu1!1֍DE43‰1!1}荄[1!1ڍ \M ˉ1!1"k]Ǎ 1!1؍7qӋu1ˍ<9!1ӍCyE‰1!1u!I 1!1ڍ b%Mω1!1֍9@@} 1!1֍QZ^&]41؉1!}1ˍǶ 1!1]/֋Uщ1!}1ڍ SD1!11؋u 1!1֍] 41؉1!1ˍ!E‰1!17ËU1!1߉ <81!12ZE Uu1M!1u㩋]ʋM1!1ىӍE 1ˉNjE!ËE1Ӎ;og}1lj!1ȍ8L*} 1}B9U40щ1}1 q11э"am] ؉1}1ˍ 8 1ȍ1؍0D꾤u11ƍKU40щ1}1 `K11эp] ؉11ˍ~(}؍11؍0'u11ƍ0ԋU40щ11  11щ׍9ً] 1؉11ˍE1ƋE7|1ލ<;1eVċU Ѝ47 1MЍD")ҍ ‹]1 *Cэ} 1#Ӎ } 1Ӎ39u Ɖ 1ȍ0Y[eu։ 1ڍ2 uΉ 11}u މ 1Ӎ3]u Ɖ 1ȍ0O~ou։ 1ڍ2,u 1ƍCM42ى 1׍ N э 1~SE 1ߍ5:Eҍ<9 u1ʍ*Ѝu 1ӆ ы^V~ ȉF\[^_]Ít&'UWVS }u ]t7WTthu411T@uWhGGTuɃ [^_]Ã?L:BKWTtFA@u1D$1D$<$yh?v(v'@@G?GTwtWT?L: A@sBFKWTu [^_] U1WVSu D$1D$4$F~T99ʃ Ѓ7EG7D7VFT!T7&@BB8uFT8V^L^M^N^OEFPmEFRFSFQuhUFBFBF B [^_]ÍG?D7FTT7@BB@uFT@1D$1D$4$V1KU@J]Ðt&U(uu]}u؋u]}]Í} tߋ]t؋E$ߥ4$եU $ȥDÉ]$/$藲ML$1ɉL$lj$踧Eu*7]C;]M]F<%uFnËUE M )Í\$L$$ƥ]r<$EѱUT$$$蚱3$ ,[^_]ÀY&1ۉ\$|$4$T$ ~9t $ VE$u|$u U|$$&Y :  :G :G :GUU1ۉ$D$ %  E$}$m$$ D$ÉD$Uf\$$ U7)t&<$蜿=v~E1ۉ$|$# "/  ;EU$D$Eމ$|$ މUE$!E$$~E$|$8 8H  =E8='U$D$ E;s&'t"u@EE$|$ ?E U$\$U}<$T$ E9v 8,7?EL$U$E$|$> ^$=v<MdUE $Q$}荈$}}<$T$ U$D$ E98:~@EE$|$x $$ }|$}<$<$D$; 'v<$,T$<$D$$ډ&{6k$X<$jE$2$T$葼=vc<$=}<$T$@E8 މuC$UE$`E:E )@ މUE$fE@E<$D$'UVS1ۃJ$ JJtYJJ11ېD t$者$pzJ1FD 95JЉ$X$Hz1JJt$8$(z1J1JJt$$z1J1JF[^][BJ냍vUWVA S<]E ]؉t$$mJ$踆KÐJK\$$J$Yu=uԡK)؃T$$R N$@ NCD$J$ĆJ$t=tD$$4 N$@ NJ$׸ED$J$sJ$t=tD$$4 /N$@ cNED$J$,J$ J$ J$ J$ J$׷ J$u= =K 1R1P ,$58Ku*t$ \$$K؉D$ K$]u]É\$ t$$K)؉D$ K$]u] Uh uu]} @<JNjtK]u}]Ét$G $o?D$G$E6W]$D$+\$UEGL$ D$ED$ED$$K؉D$ K$KP C ;K2t$G $<t$ËG $:\$ƋG$<t$ËG$+M\$]ȉ$L$ D$$K؉D$ KD$=$uG4$D$ѭ$ DjMEED$GL$D$D$ MT$GD$ED$D$ Ux ]]u} \$@<JNjG $l=D$G$ Ƌt4M8Ku5 K]u}]5$K덴&;W@É$D$)UED$Gt$D$D$ ED$$K؉D$ K$KW J ;K9\$G $:\$EG $8EED$G$EED$G}ȉ$t$ <$D$ED$$K؉D$ KD$<$3G$D$菫$ AHE]]D$Gt$L$ D$t&UWVSKJK@9J@JEU$BUP @$D$+UƍREáJL$ËE$CJC EЋU p@Px#$?Bt pZt&U $T$EJ=KЅXu E[^_]$ @E[^_]Í&U5JREÉL$E$CJC EЋU @@PJv'E8JZK[$t\$$u$tJ8E \$E$ D$.?E$ D$v>O$@ƋGD$ G D$$4 D$:>HF$ D$>F$ D$ >$ܟ >dUREáJt$ËE$AU C EJ؉P@@T$E$豱E J=KȅP$  >U T$@$bEJ K؅P$ =G$0 D$=G$ D$<$ D$<$` <U$ T$<ED$C$ȝ D$<UVS JJ190u )B9tC9ut$$ *=[J‹Bu8BD$B $yJ @t JBBJD [^]19u끍t&'UVS ] uxn$K\$P$ \$4$\$ K \$,x [^]ÐKtE u [^]vET  [^]>;&'UWVS @$q$"qt!1ۍv'J$s3C9u|$4$4$q$e [^_]Í&UWVSlEJݝ]EݝE$ݝt;Jr\$$t U;J1݅ ݅ܥD$J $r= K1=GJ$ayمUD$D$Y =$ D$ ED$D$Y =$ D$ BD$D$wY =$L$T$D$ $0 PY =$X D$ #D$D$)Y =$| D$ .D$D$Y =$ D$ +D$D$X =/L$T$D$ $ج X =$ D$ .D$D$X =$ D$ D$D$fX =$8 D$ 'D$D$?X =/L$T$D$ $` X =$ D$ D$D$W =$ D$ D$D$W =$ D$ =D$D$W = L$T$D$ $ |W =$ D$ 7D$D$UW =$P D$ +D$D$.W =$| D$ )D$D$W =1L$T$D$ $ V =$ D$ D$D$V =$Ѧ D$ D$D$V =$ܮ D$ 2D$D$kV =L$T$D$ $ DV =$ D$ BD$D$V =$T D$ 5D$D$U =$ D$ 2D$D$U =5L$T$D$ $ U =$ D$ ?D$D$U =$8 D$ *D$D$ZU =$d D$ <D$D$3U =#L$T$D$ $  U =$Ȱ D$ 7D$D$T =$ D$ ;D$D$T =$ D$ D$D$T =$L$T$D$ $< pT =$d D$ GD$D$IT =$ D$ TD$D$"T =$ D$ _D$D$S$/S&UWVS D$ D$$=\$ $C o D$ D$$=\$ $CTJ D$ D$$=\$ $C'k˧ D$ D$$=\$ $WCD$$ u@$= \$  t$\$$C  D$$=T$\$ $BR D$ D$$=\$ $B^'L$qUWVSQI\XǨ  9u Ȩ :Btv9tE˨  D$Xt$\${Y[^_]a:Bu :Bu!:Btɨ :Bzʨ :Bj1D$XT$\ $P\n D$X$ۣB \XNMu~rXP:-ud\15ggHBt#&Dwl$At$ ]|h$|hpt1p$Hs]Wp$襅1|$h$q$褵É$r]$ot$h$mq$uÉ$r]$;\$h$9q$AÉ$r]$ L$h$q$ É$cr]$؄ T$d$qx$ٴ`d$襄`$`$k`$kul$ l$Kh$hE$,\$l`$n$ 袀$= 蔀\$4$D$贌$ x$ U j\$4$D$芌$u$ B\$4$D$b$hP &U4$T$D$C>u$u$D$6{$lu$D$ {$Vu$D$ {$@u$D$z$*u$D$z$u$D$z$!Q |\$4$D$蜋$h `|$4$D$耋`UT$D$E$11#$ $rh$< d$El$7pjp$W$: T\$i@$1>s.$h\$<$轞$F謁t$`$m$貱u`$~` $r`p$n}Ef fEm\$m$d yq$ĵ h<$h$>$ $ 8`$ڀh$U]gÐU(ggHv$=$ D$U)$=L$$ D$ D$^+E ED$ED$$=$`($=$ D$(gÍU(gtÍE ED$ED$$=$ (1gÐ&U(guzgHv$=$ D$x($=$- D$ D$D$*E ED$ED$$=$'$=$ D$($})Ug]Ðt&USË9tux < t< t []Ðt&A9w &Ugt&nT$$萟g$34$#)1g&'U$n4$3$gٛÍ&Uu Uuu]gt't#4$&t$$D$;]u]Ð]1u]Ít&UEP@ @@,@@@@ ?X$@0@<@@@8@4@H@D@L@PøE < D$ 6D$L$$ p$&US]t$2$'C t$y2$i'Ct$b2$R'Ct$K2$;'Ct$42$$'C8t$2$ 'C4t$2$&CDt$1$&][]j, D$ VD$< D$$ k#vUS]$$1EX[]&t&'U"(]]u}L$$u"t]u}]ú<T$$N"uى]$$4Ez]9v1;-t0Gx< t < tB9։UwEC]9v;-uиw1j&'UWVSɉEt A"t9r 1[^_]<-.<+ES9r ;0;E E9s;0t 1}}tF$0$/UNjt$<$D$c#7E[^_]ø D$ D$< D$$d  !CE9t&@D5{xEU8u։}lj]9tt&'1ۉ؋u]}]É];"uET$$ËEB$E CE9މ]v DB tEtE@$.$/.UT$Ë$D$"E Uu1]t'$ @$k.$-\$Ɖ$#]u]É'UVSӃC F CxFCmFCbCFC0^CF0C,^C$^$F,C89F8C4.F4CHFHCDFDCLFLCPFP[^]Í& {< L$ T$D$$Ĺ 'U}‰]uD$$u1ۉ؋u]}]Í&9t)@$-$y,T$É)ЉD$$Y )FU8U@]u}EMT$$_Et 9Etø@CD$$?Eu1]u}]9t}؉ƋU)F$EV9ű}9uE$U]$)ލD0$%,$+M})ωƋE|$4$D$h>U4$T$%E}@ND$4$=t&'U@8]}ljuUL$$=u1]u}]Í@E{t9tߺ@T$$Et9Et‹u)U<$)BUEM)@$*+$*\$|$Ɖ$xExu@E@$*$_*UU$T$UT$<UU6U4$T$믉UWVSÃ@UEt2uϹ }<$*$CCEt2uϹ }<$)$CE$@$*$~)UCT$$M $y@$)$P)}|$$gC EtS҉UtCDtD[^_]Ëu׹ uPt&u׹ t&u  ׉tu  ׉uܹ D$E$t%$!)$(CDUCS[^_]ø D$U$luø D$M $Tu D$}<$<u D$<$'z t$<$a'U}}]E uU]EЉE‰9E;Ew؋u]}]ɉEt܋EEUEEE9EvJ8-tEUEUBUEE9Ev!8-tUE`MUAE][ۉ]uE]uF0F4F8F;:];!v/t$$E;E/E],L$$EE,E}ЉG0]丰u lj{ UB8EȅtMA$@&$0uȋ]sUEEH9M  -UEEC,b<w $| T$$ u4$%$UM $T$识i 11D$|$$YuV$- $V%$FM]$L$W 1D$1D$$uVr\$$ 7t&U E0G 11 T$t$ L$$UBHM\$$* k}E$|$螅 1D$1D$$HUZ}9]} ?ue lj9] u lj UE]GUE'Eb ]9]vwDP V E11ۉ|$ t$\$$UM%B, $v#$f:U E1D$ 1D$1D$$MuFP$'#$]Cd ƉU E511 L$ T$D$$HEH0MU1ɍEk1D$ 1D$1D$$MA,UEh]C8 j< t$ \$L$$ EUEEmM;MʍEt$!$UE8U9Ur< g< _<<<"D$$Ը f;uxE$ D$)CE{UЋ]JkRuމ{0UB8$ V$@$s!$ UЉB0U$T$SADP1 D$ E|$D$ $F4E8:+}G4Ẻ\$$ D$%9Ev< t < EUEtHMtA}WS$' $UB t$ $EMA U1ۋE1,T$$E;E^E,E-M̉D$$ L$ID$E$ D$-uމ {tẺ\$$ D$UB81D$ D$1D$$0Ub0Ẻ\$$ D$B9EEv z[uBEUE&UEt$UZUEUE]UEE,T$$qEa]C]$4EE8 EUB EM]܉A$$\$$ ~GUEE E$]ÉڍE;]M\$ $~EڍEڍE}EtDuԸ  un1D$1D$E؉$#UZMԉ $*$u؉4$$ڍEe;]a}<$$FE亮  ׉uE11|$t$$ UZwڍE$$\$$ E@Eq]̉D$$ \$$;@$$EȋEuȉD$4$%U@EERE9Ev8>ui11L$|$ t$$U%B,$$EyD| ƉEX\$$ B$j$Z$ܷ !$ |$H k$l ZM$$ L$]܉$$/E$ D$U܉$$$j $ u$Զ d$ Sv$ ?$G .u$ t$4$>$.s\$$H ^$ Mt&'UWVS,],M !E @ =gEUaE9U.EED$$=g&'EPU EUt̃=gF$T$É$EEC ECnD$\$ 4$ t$D$g$4$$ EPUSE$$x E$u$e $T$9U t\$E$ nD$t$ E$ D$ED$g$R1=g,[^_]$?bS,1[^_]ÉD$$ 9t&$Ժ ,[^_]ËE$ D$$$w BE$ D$E$Q$A E$>$. 5UH}}]] uE3K=gUxEt U<$ |$D$g$It]1=gv']u}]Ív$?b1$Ժ $͉|$$# f$T$ډKt\$<$QinD$t$ <$|$D$g$'~=E$ED$EU)'EPU~TE Ut݉$mt$D$g$tH4$T$D EPUE܉$4$$ E$!$ ^$Tx$E؉$U؉EU؉B UEU؉BnD$T$ 4$t$D$g$|<$$ |'UWVS,u=gElUtUutn|$ 4$t$D$g$O~1=g,[^_]$?b`,1[^_]Ít$$@ @낃,[^_]EED$$Etփ=g&EPU~evE Utڃ=gqnD$ $H\$D$g${}$3$#EPU<$$E$$D$$ PzE$ D$83vUWVS,EEi=g4g1D$E$iYEE|$D$$87%D$$DtE܉]$8 ÉƉڍEeE9t$v‹E…U$TG$É$UEt$$D$ ED$uE} +} -E $$p$`vE$ D$E܉D$E$h D$${$#$<$C?gt $ n,[^_]Ít&E$< D$E܉D$E$h D$^\$$+\$$}$ E$n D$1EHԻ < t$ \$L$$f Ի D$ D$< D$$] E$ D$US$]$D$E\$ T$$%t$1[]À}u1}$[]Ít&'UuƉ}׉]@9F M|.XF^[$[\$$o$'FF N]F @\ ]<\ ]u}]Í&USÃ$=u&&$x@=wY[]Y[]Í&UWVS @ ~1E(t&==E E9F ~V^؋XP=uƅu؋C t$C$3C $)$EE9F F$ $FF FF [^_]Ã\Ct$ $C$ $)vJ$ ${&'UWVSE $i M1 $111f11f1ƅƅL$T$$} <$1 t&E Í0vE $B|@.w$ ||$E $ wÃ))_U $t@M $SB} f<$ABf<$B@<ˆ<! E$x D$D$Č[^_]f|E L$D$ D$D$ || *$ $ ËE $LAU f$N?CM $0A} fC<$!AfC<$%?C<$?ЈC C@C 1ɍ$|F )‰||L$} <$ f| vYE \$LL$$D$  | | Y|T$M $= f|v܋} D$LD$$|$  ||U sÃ))B$ E$/>$w -P$ P\$D$$9\1L$77 Ot$D$<$[t 'U 11$dE NÍ088\$GL$8 $oL't#렍D$8D$ $5L} D$D$$8|$ (EUԍỦMЉE؋T$D$E$許Č1[^_]ËE $=@p8D$8D$888$@K~VM L$ ~D$D$$8%~D$8D$$J)ޅG1o9ƒ))I~5U T$ ~D$D$$8)ƅˋGr މtE $8:|CD$U $|)|:p|$ $gËE $9U $9CFfC$$0M CL$ S$T$T$$|)|z4$W$C |$ t$|$$+$@1۹11ۉt&F 9Ё8uރxu؋x(@9W;8GF D$GD$$gt@Hhgt,$Q+t$ $(D [G^_]$˾ a [G^_]ÍUSÃ$1|gxPHhhƅh1h|pgH4hg4$t4$$ET O$$= A$\$$D$[04$$Q $t$4$D$(0?$D$c$ #\$D$$/g=lt&EЉ$腩|5g%EЍ^$ghE$ƅhFg؍|p݅gݝh݅ݝp݅ݝx݅]݅]݅]HhggwBggB1ۣg|ƅ-|1ݕh111]݅p]݅t]x|Q  t$4$$\$4$$ ݝ@Ɓ@ @ $T$F݅zwuu1|݅ $ݝh݅ $ݝp݅ $ݝx݅ $11҉ @ @  $ P  @D$$-tËt${$k$]@$$4L$$HF 1݅^D$$ڦF<$܍ٽFFf fD٭D\$٭FOF$ T$k|O$ ?+$5 N|ƅQ$c +|ƅ.|$H $H  $"|ƅ4$$$Q \$ $D$+4$6"$N p $"|ƅj؍~|݅gݝh݅ݝp݅ݝx݅]݅]݅]Hhg|4$- 14$D$L _$:N$XB94$ ݅\$\$$G|-݅811҉L$T$ $Id4$X $" i$V$@ Cour@ier1P ?T 1H 1L 1 u݅11҉t1ݝhx݅1p|}E% fEmmݝH݅Hݝ\F+$T$L$訚P$ D Nݝ8^Z8ݝEݝF8ݝEݝ281D$\$T$݅8ٽF܍Ff fD٭D\$٭FD$ ݅܍٭D\$٭F܍٭D$٭F:U?$x 4$|ƅݝ8USÃ$$EE\$EE$T$[]Í&'U8E]]Eu]}8$gB$1D$AE\$E$蟱U EE\$E$t$$A<$]8؋u]}]Í&'UWVSE$Q5茒붍v'UWVS} <$<$@$,$EƍE|$ \$D$4$=)Åٍ}|$]E$D$p_U4E$>E1D$$=|$T$ \$E$dE1gME~T$$U{4$$g9v"Hght$g9wދE$ $]E$D$<E$3EČ[^_]É4$:$*$7 EEČ[^_]$ ՗E8$ 轗4$$E$ 蘗ElUE]Ðt&UU]RÍUE]] u}Expx|%ډЉT ȍ‹E~/]Ћu}]؅Eyv]z͍UWVSEU uEȉljEىEEUmE؁ЋUЋUEeU׍<8E9sA119v)B@ t҅yGM?9ڃ[^_]$ 舖]=]+Et&USE$vxZ[]É$2 4Z[]Í&'U}}]1ۉu1v'<$C4u]u}]Ít&'U}}]u<$V~1&<$F7u؋u]}]Ít&'U}}]1ۉu1v'<$C4u~]u}]Í'U}}]1ۉu1v'<$C4u]u}]Ít&'U}}]1ۉu1<$CA4u~]u}]Í&U}}]1ۉu1<$C4u]u}]Ðt&UE$~-ÐUx]Ðt&U1]É'Ux$1xÍt&Uxt$=x xÍt&$8'$`Í&'USE] t7z T$$tt] E[]1[]ø dL D$ \$L$$u UEt T$$rø L D$ ZD$L$$u ѹ'UEt T$$"E L D$ PD$L$$u zUEt T$$EI L D$ DD$L$$u *U $Ét$։|$t/@t;NjCt u0t;t&t$t$|$]ÉCttԉ!ɉ뾺'D &'1E oE buE QE Dt&U‰t5bcci@B@@@ BBø D$ uD$ D$$ p&USÃ@@@ @@@C@@ DC(C,C0C4C8C$CTC<C@CDCHCLCPCT@@@ []øB D$ T$ D$$ p&U$Ét$9 |t$t$]Ë$1t$]94 $t$]Ðt&USÃ$# !9t2 9t$ 9t Y9[]Y[]ÉUWVS D$$B zEX4 D$$B z$ 1}z'uUB8$& D$Pz}D>8F$% D$7z~$?b&z$ zGB|t&^&x$W y$?byEXPa |$$B y$ yUBLď \$BH\$ BD$i \$qy$y eyu츬xǹT189uUBT$& D$ y}D>TF$% D$y~$?bxMtW$ 1xuU$& D$x}7F$% D$x~$?bx,[^_]ӣDJ@t,%DB@tDr@tDZ@9 \$$Z <$E É[^_]$ ah1һ(?y0$ T$ T$D$h$ $| 롋E$ D$g1ҍ( 'Ux~Hxet&$ gÉUSxU] ~~E8 []xg@xxT$$x\$Ċ$[]&USMttt$\ g1[]Å~>Aw_w21Dw;wC9؃[]\$$ f1[]ސU]Ðt&U]É'U]5$ÍvUWVSxyE1gfff))ȉ07Gu݉E~%L>1ۍ33CI9]u>}[^_]Ír-E|t&U@$]ÍUUt ]@ $]Ív'UE1tB(]ÉUUM ~@@]]ÐU~H]Í U~!1҃'BT9uX$?]@$11l$`$1 d$h$|$Í&Ut$]Í@$UVuS tA(u`11ҋ $t1 Ӆt2h$)Й1)ѺVUUU)R9t x$h$[5t$^]Ð똍t&111댐&UE@hPPPHPPPXP`PP P(X0P8X@]ÍvUW1VS,~j&D5 R }E% fEmm]ظE D$$\$ĎljC9,[^_]É'UVSӃ ED$ $\$ D$肎r9sR.tov9.t7I9rvu;-u {0t&t [^]0C [^]9v,0u' &:0u JH9w9uH뢉썴&'US]E $$[]Ív'US]$E $[]Ív'Uuu ]]$}$ x$;F$]u}]ÍUWVS u ]$$` x$;F$F x$;F$) x$;F$  [^_]Í'UWVS $uEPUE E$ XE @E$ XE @E$w XE @E$Y XE @ $< XE @($ [^_]ÿDU$t6t $Ë |$ u T$$Z;L$$ E;1ң@$x$$Í&UXE]]EuƉ}]t&/v'V$$E<$ ]$D$$] $ƀ ƀTƀmD$q:5H$u=L$}h$]EX$E`$]EE]EE]EE??EE]EE?]EEEE]EE]EE?EE]EE?]EEUD$$ U9x$~X$ٞt:`$ h$\$11$1H$1L$1D$1x$z`$ٞuzh$t uX$`$덍U$t t"1҉ $D$Í ދ |$ tT$$Y8뼍& ߉'UWVS|E}u E~ɋ``F $UF UF(UF0UF8UF@t t$ɍ]]]e$fEЉt$ D$\$<$5$fFht&EEE\$E\$\$$2d<$ 4t$$8ÉD$G$8D$/7J~<$9\$$ D$Z|1[^_]Ít&]]]]&U$t$E] t(E E $t$][@$~H(t 1=t$ ֋h$)Й1)ѺVUUU)R9t  x$5h$ $$t$]Ð$$$t$]11늉'UEttD$$  [1á $É$$É'UST$E =t$]UMEEP$$U$ $U$U]]U]]1D$E$l[1D$E؉$[[1D$Eȉ$J[1D$E$9[EEEwEwwwEEvEwEw &vw}[[[T[]É|A&PU$$U$ $U]]$U]]_~UX$R$ɉ]ˉu5$}tk }E% fEm m]E$] }Ef fEmmE ٍ&$D]u}]Í&UWVSà  $$AR$$1ɍp DwD 3U1ɍp 31ɍDmpD U  3U1ɍp 3DlD DS [^_]Ív'UWVS\}u~y $@XR $]}Ef fEm]mE{E)R $}Ef fEm]mƋE)E ;u q $~EP$wc ٞwR;u;5$ ؋U MЍD$T$$ i&W$Eȉ4$]E ]E]$D$$]tƀ ƀrƀeƀ ƀfƀ ƀQD$$M0\[^_]Ðt&E;$|\؋MEUE L$D$E $3\$t$$ JT$ >T\$D$$ %T$ T넍&US$E]9E]|2X$\$$$ӉEBEX$[]ÍvUWVSE} W=~A1 C D$E$zu U ;SFT9u֡9 }E<$lU=$?bySF|$$ D$bSFtD$${ KSFٞFٞF$ٞF0F,xD$$ RFDtD$$ RFHcFL H$?bRt$ E $\$E$0UBJFUCB]M}A<$z@$)$葇UB |$$}M} Ay$˗ntMA$}G$G(G$GG G,G0?GDW4G_\$$ P\$$ P$) OXUBD$ O8MAHAL$D Ot&UpPtD$$K N$pq&USE]E]E$]lQ$dQ$W$E]E]EEEEEE]]EE]]MME]MMUUE]XĄ[]Ít&'US]$t&t $u'E []Mt&Ex []Mƀ Ptt,Ht5T$$)[]ƂrQƁgƂkQƂgQ뿉US]$t&t $u'E []Lt&Ex []L>ƀ Ptt,Ht5T$$C([]ƂRQƁGƂKQƂGQ뿉U]]u$t%t $u!E ]u],LEx vƀ ptStzJD$t$$?w6t5t@HtRT$$U']u]ƆRpƀGƂrƂgƂkƆKpƂgƆGpit&'U$uÍED$E$ƾE$E$ Í&'US]1x$5p$UX[]UVS511ۉD t$$uDt$" FT95@ @$p$`ut$W$Gu[^]DmčUS4]E$$1R$ P,$ $6s}Ef fEm]mE$yأ$1}$$`[Vn1111114[]Í$Gt&]؉D$$ HE '1ɉ $vUWVSE}&E;];@$/E̋u58 H$L$U~$]EU^ t(~$1 EAF 9u}~z $@XR $]q}Ef fEm]mE{E)ER $]q}Ef fEm]m֋E)E t$D$MU =x$E)E)…t&[$1ɃF,h$]F4"$ؾ5$ |$E=U1~O1ɍt&E 0 0 A;MuED$$G"ED$Č[^_]ÍvD$U$i T$TGČ[^_]TUE1 ${$1ң|${(…ɉC44X$ ٞRx$CX$C,5h$`$WCS $]Ut$\$$Nq$ƀ pBEM$u$ƀ ƀTƀfD$ C< \$D$$pD$$ C^(wP=|$$$<BD$VC,`$h$)Й1)ѺVUUU)R9j[1=t$-W nW A;M&e]IE5x$H$u} )ơL$)ǃ1D$$_ |$ u T$$:]؋E)] )E} U=L$1H$=D$7FP} } EuS ?J1҅~5FH]FLD9ˉEF}xb$haUME}EUU܉T$UT$ U؉T$L$$E؅5E])]EF YEN1һ}f :D:~  9U UT$ ]D$$\$X$ AvC$p\$$ET D$\@CW} vFD ?1҅FD]B9uqD$$( ]@$T 1A E1҅,FH]FL1B9u M؉]MV$<$X$ƀ E}Ef ufEԍm]m֋U]܍l$ٞ=7iع 0 Tr f3$c @E\$$EU |$ u $T$1x$W$M؉4$$ }Ef ufEԸm]m֋UM܉Xƀ ]؍C$CC$YC V$M܉<$$ }Euf fEԸm]m֋U&M؉Xƀ  %$ = M܉]MW$4$Xƀ $E}uEf fEԍm]m֋U  |$ t$\$$9eU]0Ít&U]ÍU]Ít&'U]@Ðt& 1U] Ít&UE]‰UUw &Bwt&Bw Bv] Ð荶UStCXt+Y[]Ít&@ËC\$D$$\W$蛤4$D$O$腤4$D$9$o4$D$#4$ $t ͮ\$D$$4$$)$蛮\$D$$蹺$g v$h\$M4$D$胺\$$ $r 5\$4$D$U4$M$+\$D$$-4$UUWVS xU~6@1F9C(t!UËT$$Wu [^_]à 1ۉ[^_]Ít&'UWVSӃ 9PH| [^_]Í@L$Ef[T$$Sf$ fNH9ˉ‰FL~zI)ύD<1ҍ'B@@@@@@ @@@@@ `9u^H [^_]Ív'U]ӉuwXt;;^Hw' VL[u]]Ѓ`Í1ɉL$$ /Őt&T$$u /;^Hv'U@SU\ËtCE[[]&[$CCE[[]USU] u'\d[l[t[X[]ø@@t@@$[@,[@4[X[]Í'USU] u'\CdClCtX[]ø@nHXCX$CX,CX4X[] U@WVSl]u ]Nj@XEȉD$$EwFEٞA$D /-$h E\$E\$E\$ E\$-F\$F\$F\$ $ \$,$ ,FFF\$\$\$ \$$ ,E.5 R }E% fEmm]E $$D$ȤEn5 R }E% fEmm]E $Ş$D$yEF5 R }E% fEmm]E $v$D$*EF] }]R E}E% fEmm]E $$D$ϣ$ 胨\$D$E$蠴E$蕿D$GX$薣l[^_]FEw8FEٞv=v6v s+GX4ːt&'USt:;á$D$訿\$D$6$$[],U1҉Ít&'U(}}]uu  tBu  uM~sC$ƅu(t&E$ D$}*$ƅt݉]u}]Ëu  18uC$$ '*|A  t$ \$L$$ Qt&'U(]]u} u7Ptv5Pt]u}]Ív\$$X )4 uLt=5L u0@5@!P{L( u;Xty5XP{W D$ T$ D$$ O޿  18 @4肙@JsXx'U(}}uu ]tu t[;Cy;s$]$K]S CP @@@u]}]$]$]@ mn C |$ t$\$$ NUWVS,EUM܅$ E$$' ã\$D$E܉$uEEY$źlj$軕$9 }\$D$$蛯$EvEE }FtStMU%NjFW$$艘$Q \$D$$}荶U$$- Ǣ\$D$$Et!$4 袢UT$D$$轮Ft 1 t&W$$ߗ$Q Q\$D$$oZU$_$> !\$D$E܉$>U$cU$VEE,[^_]þ  t$ \$L$$ SLt&'UMU tT$L$@\$踞ÍT$L$@DD$苞É'US] t$蕤1u 1[]$ѕ\$UT$$)[]ÍvUS|] t$51|u 1|[]$q\$U|T$$ɝ[]ÍvUWVS<$C Et$= f\$D$$脬$- Ht$D$$fGWËGH?D$$IGLt D$F$5GPt D$F$!GT-D$F$ GHGLGPGT$ 號\$D$$跫GXt3$訶$H j\$D$$舫GX$譢G\t3$n$57 0\$D$$NG\$s$iG$^GGXG\<[^_]ËUԋB UWVS,uE܉UGE$$4 E赜$= 觜\$D$E$ĨW$$$Q wU\$$D$蔨$- Xt$D$E$upEG~Q]1&CTCF$9D$E$:U$ڃ`EP9u$ ЛUT$D$E$U$E,[^_]Ít&~EE&'EUE)ރU~OE$M؍[ʉ$EGÉ$]U$D$^$v}u/U؍[CC$D$E$U$ډE3뫋$CU܋B $ѱ$4 E蒚$= 脚\$D$E$衦W$$$Q TU\$$D$q$bC6v'UWVS,pDF;pH&GËtHt$$ C$4Ct t$$ g$ CXt"t$$ @CX$CXC\t"t$$ C\$輜C\CUЅ҉EqEԉ$蛪$= ]UЉ\$$D$zEЉ$o$ L1Uԉ\$$D$NE9Et$nV@QE@\%UB$$) ג\$D$Eԉ$F5 R }E% fEmm]E $$D$豍F5 R }E% fEmm]E $豇$D$eF5 R }E% fEmm]E $e$D$F 5 R }E% fEmm]E $$D$͌$ 聑Uԉ\$$D$螝Eԉ$蓨UD$B\$葌EԉEEUE(9UEoEԅdE$G$=  Uԉ\$$D$&Eԉ$$ LݐU\$$D$E9Et$U$ߧ$衐\$D$E$辜Gt;$诧$OW qU\$$D$莜G$賓GE$術TE$YD$T$XU$mGtPGzW11ۍt&t$H$=WF(9w݉$H$=Gt$H$x=EEGEG 9111ۉ$CH$3=T=5t@$h$ *\$D$@$ET$h1ɉ T1v'@th$pEP1U$á8$褎\$D$P$迚E$ߍG$!w ȋxPtQ D$@$I$x$ P$e1P$F$;1@Uċ8Etq6Ɖ$‰NjEP$$$Q 葍\$4$D$豙$ uUĉ|$$D$蒙4$躐E11N1ɸ@ 5@VDtQ D$@$$dw$ D$21DHt> D$@$較$ HH$1H$ x$= j\$D$@$腘@$訏1@Wb;V(t$D$9l[^_]ËU$*$\$D$Eԉ$ UԉUUB\U$TEkʀT\PWP\$$XP$苢$ M\$D$@$h!D\$$D$E$ \$D$@$"XơH$ }$ ˊ\$4$D$4$$ 襊\$D$@$4$vUS]t;u []Í&$06@$C$C\$$,9[]UWVSEU EEUUEEUE=~f51C9tTU$T$3uEtKUt;EUS[@[@[@[ [^_]E [^_] F 9F}VNFËEt5E$-5@$B$BUT$$8FoXF^ $A\$$B$AN~ 9‰Fo1ۍ‰C)B(9uF$ C vt&'UVSu>9|5X$;A\$$OA$A4$4@$pA$@t$$6E CC CC[^]É$@ d K UWVS1ɉã1 A1 DuCP1CT1Zz11҉= |\L1dE裄lEtux=0u1<[^_]ËE$S1vU |tiC$>$ >UT$$(41<[^_]?*?$D$辝$fc)3C$8>$=ã(E$0D$U$T$2M $0(D'UWVSL2$֬t $l 4@Ƌ|$wq|$BFHF@$Lq~+F@$FLD$?bD$F@$F@$"F@FD$FPD$?bD$FD$FD$FDtE$p~9$茚FT.&F@FH:FLwFT~<Ix$ $D$?~$ $D$'~$$ ۂ$D$~$+ Â$D$}$2 諂$D$}$9 蓂\$D$F<$谎F<$襙$h g\$D$$腎F<$誅F<=0uL[^_]á($-$d;$:)lj<$)iҟ)ӍC D$ (\$D$ 0A L$<$Giy$(uQ$*uE|$$ 5$h'<$H:$8/L[^_]É$Xh11T$D$<$ $D<$9$.$ \$D$$L[^_]$$y\EЉD$N$@5N@F@^DFD($$8EEE\$E\$\$$ %^Dt&t|$$ |$$ $tF@d( n |$ t$\$$ g* USDEUU9]]E]E]}V@ËCtVC@$#tCDsCXC\C~J1ې&E  $\$c$@D$E ݜތC9uD$$ $E\$$D$D$$ 1[^_]É'US$E]i݀Ez u ؃$1[]\$$ 蒘$ƀ ƀwD$!1Eݛ$[]US$E]݀$Ez u ؃$1[]\$$ $ƀ ƀMD$1Eݛ$$[]UWVSӃlEEt ]u]Cٸ D$ D$ D$$ &U]Á0utNCt$$ 1ɺ@C10C4$T$D$ ]u]ø 2 D$ t$\$$0+vUVSExzp;5| [^]y$( ;5}፴&D$$ 苹 $$;5|ƒ[^]x D$ D$ D$$ xUS=~'&$$1Z[]$ M鍶US=~CO$G$7L$$ 蚸w1[]$ v'US=~'$` $$?u[[]Ðt&U]Éut6$$h‹C23BSuSu]]ø D$ D$ D$$  USÃ$PPPP X(P0P8@@T$$]TCd$E\$T111ɉ11҉ 1$$@Eݛ (,荃0@@ݛ<0$[]ÍvUS$@$5ڸ1Z[]ÍU1S1ۃ1$@w$ڸY[]9'UWVS<-$@/$0U܋00GE^G^G^G ^ G(^(G0^0G8^8E0~\E1ۋUE@JEЍvEAE؍4ZA Z AZAZA$Z$A,4Z,U܋;EU~'1݄njݜƌ@9틇^@݇ ݞ  ݇ݞ ,݇$ݞ$,FdEԍGdUԉD$$WG@D$$WED$E$LE$D$WED$Eԉ$xWLD$$ W<1[^_]ø  D$ T$ D$$ nU]Ðt&U]]u}u1]u}]ú!T$$et؉$.M|$E$^ xJ=u/1D$E$6t>E$?<$7<z\$$ b뿉\$1$ ‰\$$ 밉<$1;3t&'UWVS<]} $1$ $T \$Vb\$E$UE؋ED$E؉$P EعL$$E1҉T$${X D$E؉$ D$ $D$D$E؉$EFEt E<ttE$C =v tGPuED$ EL$D$E$~UvD$D$ D$D$E؉$tM1PF!E܃vUWVS<EEEԉ$UBU MغEEUؾ1ۋ}؁ U =EE[t]EtMtT$$_t<C1$HU܉$D$NCEtvM< uCuu]܅><Mɉt/U$9$> G\$4$D$S$K GM܉4$L$D$SM؋EU؉|$D$B$wM؉EԁEE9J<[^_]S$$<D$E܉$?BM܉ $OJU1kU$9SEE E* E01҃M؋< D$ D$L D$$* < D$ D$L D$$W U $D$ D$FD$$G4$$ < wPT$D$$>\$ |$t$$>t$\$<$$E[^_]t&U$]uƉ} ~ \$t$<$Q )؍D$` D$$2]u}]Í'UWVS<] }4$=$ D$ &D$D$$=$$b 7$`D$$s $`D$ u4$=t$$ D$ &D$$=$1$ $D$u$ $D$uE<      $];$k$$$ T$PT$PT$P T$PBT$ @\$4$lD$4$t$$D$D4$}$m$K$A n L$ T$ø D$$$,\$$D$C$$<$|$$D$tCE$$D$ED$RCD$$ =D`=`u $4: D$ D$$BD$$C=  @t$$D$O: p  \$ L$T$$:= @@  @$U9 D$ D$$B|$t$$B  L$\$$ !"#A T$D$$AD$$B=  $D$D$ <tX<$ y`@<[^_]É =   e@D$ `  $D$v8|$ t$\$$.9p1ۍ&$7 $D$D$@D$$mA2uE   @tvE28ˈuD$ÉD$$7@D$ D$ D$$D8E}wQ1$6 $D$D$?|$$}@2u$6 ` L$T$$D?D$ D$$&?D$$@D$ $D$6@D$ D$|$$?7E@  Dۣ$H(L,t!1ɍE28وuþD$t$$5@ L$ T$D$$6E}\ U`]ÍUUt E B41ù  L$ T$D$$UUt E B1ø D$ D$ D$$UEU t!ttɍv@8@@ɍt&ø D$ D$ D$$`&UEt@4ø  D$ L$T$$&UUtE B4ø+ D$ wD$ D$$&'UEt@ øo= D$ T$ D$$&UEt@0øS  D$ gD$L$$O&UEt@ø D$ 2D$ D$$&UEt@ù * L$ T$D$$&UEtø D$ "D$ D$$&UEt@ø D$ D$ D$$O&UEt P$Ʌø  D$ D$L$$ US]x;d|\$$ ʺlۋD []Í&US]x;d|\$$ 芺lۋD[]Í&US]x;d|\$$ JlۋD[]Í&USÃt$a$QCt$J$:Ct$3$#C0t$$ C$t $ 豹C(t $2 螹C,t $ 苹CCC0X[]ÍUVSu] t^tZ$wtFt$~$n$f@$$=F\$$V1[^]Ðt&  \$ L$T$$P $ 轸뺍Uuu]tKF,t F,]u]d)F,$MU 4$= 4\$D$F,$@뼸j D$ YD$ D$$3t&'Uuu]F(tF(]u]Ðt&(F($ET L4$= >4\$D$F($[@FtJ6x$Y 4$ U 4\$D$F($ @yp$g $a 뺹 : L$ T$D$$A'U‰tq@@@@@Bf@@R8BB B$B(B,Z@B0B4ø D$ D$ D$$UWVS,EE ]؅UEEZ@ۉEtk| |$$stp t$$^t.$E1Ed X$|E_Ed~811lËCw$ D$$ 訵GH9=d̋=dh9 lˉ@UEE؉C [8$@$$xML$$E$t@$$KUCT$$aU1tMAHC$C`d,[^_]ÍvD$E$GC8E`t|$ ED$U$ T$)뚍&D$E$U9S }MAH;CtGH9=dFuE$ D$轳ES MAT$D$$ 荳|$E$ D$v,[^_]ÍXlh$\$$$lMEEM qUB0D$ B4D$BHD$B$iEED$ED$UB$#=d~Vl1CH9tExu;puM9H u`߅\$ L$UB$ D$Uh9*lÉ;M`sCK d{E$v D$C D$UB$ D$ر|$M$ L$/$C$vlj$|1ɉL$<$wNMQ,`MA,dUB$ D$l$ {뤍Xlh$\$$$YlMA0D$A4D$A$E$t EX$oxKC$?bw<$$ D$_UB$8 D$I$ x Cؿ/v'US]x";d}lۍƒxt1[]É\$$ ԋ@$tE[]uUS]x2;d}*ۍlÃ{t%K0t6C0[]Ív\$$ 蠯ċC$sE[]&t$:$1ɉC0T$L$$뚍US]x6;d}.ۍlÃ{t)C$t:C$E[]\$$ C$rE[]$$rBC$뱍'UluGr1d$h9$lù)  L$ T$D$$@ KvUWVS =1uuG3ON)ʍ R )ωAD3CuF [^_]$$x1뜍&USEtxXu$a[]ø D$ D$ D$$zUWVS,dEEluơ`\~4$W$ D$Ǭ=`=`~Q4$$aU D$虬=`~04$4$$$aU D$`~F$$@8E 4$CEE$$#$ .<$+F|$ `T4$&'V x~tF0$D$=`t~t$u x&EEHE9dZ5dEEt&~td$t:$4W$>$jk'\$D$F($31 L$F($vF(%V$~D$4$q~F $$g$4$V\$<$T$ D$F<$&$DU &\$D$F($2N,t)<$&$Q &\$D$F,$2<$m$]F,t)$=$MU h&\$D$F($2F(t$)F,t$)F$t$)F$F(F,lE܃EHE9dulދF ~`$ %$jk%\$D$F($1.`dD$4$4$` 4$`94$r_%  D$ |$t$$D$$ 莨[C8PD$$` 膧;FEt&<$<$;$1 $\$D$E$0`FD$E$ D$谧D$4$4$4$\$$ D$ll$$11ңd1lho-x,[^_]E܋}\0@&E3C$CE$v=~ ~wUOET$$47U$W7‹@tE4$D$$ D$$\ E3CFCE$to@tE$1C]u}]ÿU  |$ t$\$$ zt$<$$ D$v멉t$<$s$ D$S농U(Euu}} ]tMt$|$$=1t CtC]u}]Ét$<$$4 D$ٝҸl D$ D$ D$$ U(uuE }}]E|$E4$D$Z=t/tu]}E] CtP$1$ $ACC\$ |$E4$D$6덉|$E$$4 D$o  L$ T$D$$ U(uu]]}}t$D t1E |$$$` D$_]u}]ËE |$4$D$E]Hf[^_]Í&UVS]tt"L$ T$D$$ ӈs9Fs7^tdN1ҍ'DB9uE CF[^]ÍF$̽\$$$蘽^ۉFuN뵉'UVS]tt"T$ t$D$$ s9Fr-F$C\$$W$FFNU @F[^]Ðt&U(uE95}׉]MEw@$ļ\$$ؼ$萼 U@ @PUfP]u}]ÍvU$μ$6$9$Í&UVSutP$蕼$0@@@ @4$ս4$蝽C[^]ø C p D$ t$\$$rv'U(]]}}utt"T$ t$D$$ ~/sN V9w+FV |$‹E $D$~ ]u}]ËF:^$\$$($F맍t&'U(]áuΉ}ׅt;tO\$ t$D$<$9;t ]u}]55~|7 u1ɉ ҉L$T$$'UЉ]T[t&'USÃUt;tC\$E$j;t []Ít&} t []1ոD$ED$$뻐t&9Ut ] j=O~] VU(]]}} utt"0L$ T$D$$ <$9[Ƌt$.$u]u}]ÍF$t$ܸt$|$$¬0ƉU$]u}$'$菸GƋE$藫u]u}]Ít&@$$MU\$T$$0UVS]tt"T$ t$D$$ Â^ƋCt.$$$4$D$D[tu׃[^]Í&'UVS]utt"T$ L$D$$ 0[t$o$_ufC[^]fsF$豷$t$U $T$0[^]Í&U$]uu }$T$輶ÉGuf@]u}]fpF$$聶Ut$T$$d0뽍t&UWV1S]E 1E0, <^wU)\(EFG9}t]E9u}$ ŀ, <^v'E* G0\FD$EL$$R9}uv[^_]ÍE0\D)yE0\D\eE0\D(Qt&U(}}]u~ G T$|$$0 D$ $=/ $d G HG _5  G]fiE~Ut"L$ T$D$$ =EEUË@ƉEG3$UJ҉D3EHG$4U1'  1}u15? vkt&'G<$˳]u}E]鯨&_ NG HG ]u}]Ív$P  G$؋ 7G/ D$ GL$$D$蛨1uUG$G$ٺ< ? CvGЃ럋GlGG"GSvGvGv{GcvkG3v[$H蟲$@$ڣv҉U',t&'UWVS ]tqs trS11D t $ SDt $ SG9{ wщ$y$iC$$^E [^_]G [^_]ËSU҉WVS<]u EЉMȉU)ޅE%F$}v$ްE؉\$Uȋ$zUȹL$t$D$ E؉$1U؉ӉUU\$<$2\$<$?~ 1҉D$1T$ 4$D$E4$r$b\$<$1\$<$R?tC1D$ D$1D$4$藥4$%$EЅt6E9Eu;}t)U؉$$EE܃<[^_]Ít&E[ EE\$$1UUԉEԿX UȃEET$\$$ @UE܉\$$0uuU؉$b$RE܃<[^_]$_ y}܅tϋE܉$E$E xE؉$$E'USÃ$]Ct$Ȯ$踣CCt$誮$蚣C$蓮$胣[[]Í&UWVS}E Ett"L$ T$D$$ x_3taC0tS{ËEtFUT$$MuӉ4$yC$nC$E[^_]ʢ[^_]Ív'UWVS]u }tt"uL$ T$D$$ ,xt v[u 5[t,$M4$D$yuߋC${u8$ }$@@C4${[^_]$ }wn$ lwC&UWVS]} tt"PT$ t$D$$ wtt"QL$ T$D$$ vutU suVt&vtH$<$\$$1uՋF$Z<$REF[^_]$ #$苫@@FE>F1[^_]$ &vQUWVS, WJUEMEB UEMBA$蟫$uUB Bt=1ېMDC$D$u D$gL$<$D$*9uƉ<$$z $= \$4$D$E$7$= \$4$D$M1ҋA RP,$$$' s\$4$D$UE<$T$D$}M $"$<$,[^_]Ív'UWVSÁ\tL~ 95$=tM; v$\[^_]ÉD$$ it֍&$x &17\[^_]ËC 4$D$ D$뙋C8_ e|SBD$ B$D$ D$藞!8{G $n$֨WG T$D$ $謜G G=1 D$$MbDE$ި$F$ tË\$$1D$ET$ D$L$$S$$؜M) )1RP,$$,$[ \$D$$c b ^$($?b %[[{11ɉ2;9BY;S҉t‹tXzC8)<$/11U#t[(tV/vtNtD[t>]t9{t4}t.%t)ҍCx;;,!<]v#T; WЉ2; bW뛋Cx[;1Iɉ~K˚@ D C%@B;u݋9<jfzF0ЉDD WЉ!CA9D  ~W롋C$\$ 0t&060m0n] >cv(OfxtR1ۍv'D$ <$CD$D$NB9)K$4 L$lZ/CD$$L$$ȥ_$ Gm$ \$D$$=+ D$ D$p D$$ &UWV Sƃ 2u J vt,^6tȉ^뼍 [> ^_]&US]tG~A  v? v ]u}]Ë$ $ Fv[ˋFqFf밋Ff렋F됋Fv뀋FmFv]$_$ǛF<$|]u}uE ]$ &$莛FOQPQfPF$$RFC CG@C<$E<$U4$T$D$x<$0E E]u}]$ k$ӚF@@} u$ 16$螚F@@&t&\$C<$#$4$D$<$9rӍv$t&˚$3F<$X]u}uE ]$蕚$F<$r<$\$4$D$8^$W$这F<$4$\$.vUWVSLE }]EEEEEuEE8D$ D$$Ht&'1D$$Nt,ueE̅uD$t$<$muEÚt)ЉD$t$<$?$G1҅u3L[^_]$ b$GL[^_]ÁL[^_]$& `b먉'UWVSEu tE$$< b4$J E4$4$;|$Ɖ$M 4$L$4$4$wq1҉T$4$U$Etu tSE$ D$_a[^_]É4$$$ &aʼn\$ED$M $y[^_]Ð\$ML$E$j1[^_]$ `[^_]Í&4$E'6$V |a8U($u}lj]Ƹtt"E\$ L$D$$ a<$w4$m\$$a4$Y[ T$$|$4$]u}]Í'U]uΉ}Nj@$1҉D$1$ct>$L _$:1t$*1]u}]Ðt&Et$E$$g T$$t $t]k$L ^n$ U$]E츺t D$$,t$~u$!uEEE$D$OEs$<bU$U}Ef fEm]m΋EEDBUuE$El D$$yE$U$bEEUE$D$EE@D$E$sËEU$[y$Bh$E$]U܉$MUE}Ef fE̋Em\$ mΉD$m\$m EE9E0J}EMUEf fEm}m΋ED$ 1D$ED$E܉$wut $r \U$Q%&UWVS\u E$蓅U$T$D$8tE0E\[^_]É4$L4$EE EXM}<$HWD$E$eU$躓#M $ς t u}<$舓|$ $8ø D$D$\$<$8M  8EE}1$8D$D$TUD$$8T$8Eؠ8$8-M؉ $8\$p\$<$1r |$t$É$$}Ef fEm]m$ЅMȅEE8 UȋT$Eĉ$5MĸD$$8L$yt$]U9}ĉ<$ |$$8øD$28 E仜 D$ ED$\$$8ׄMUʋM9Q qeE$ YEt$5Et M $#E@U$E4}ĸD$D$$8|$ 軁ED$Uܸ M8EEET$ L$D$$8uUntft&\$$ X}E9GvHvڋMyxunAUT0UfT0ECU92 z p L$ T$D$$ &$t 2XEUȍME8pE4 D$E$Qw$蟿6$}Ef fEЋEm]m҉$[Eȅ E}G&M}L$ <$襀|$D$$x$ WWEĿ\$$U|$t$$8D$ 8 }ؾ<Eا8<t$<$\E\$<$D$y%EME T$$E$Ft6$4 uVkE$E$EF$sM}Ef fEЋEm]mҋU=tE$$EF8$ U|$$ UE,U҉u]}EUtH 9r-Ut$$X T$UƉ]u}]Ë@EUE<t"<uuZ t$뻍&f9ruȍzR9}UvEEMȀ8t$ TB_P ҉UE赾0x;u}~ŋMP}U;|MuE$5U$xU}ԋM׍GF9EtMG } D$EU$|$JE]x4$C ZEUM$D$E뿋XpEM$D$$膻t]$ SU$W EtӉ$twG11ۉEԍt&'EQt&THuAFT=D=EԉD$ED$$&95w$A$贂$w c $D$C D$wyn e$?bLu*$u D$L$N<[^_]À=1~̓=1 wD$$0 D$VL뤸 ޡh $D$ 1D$@ D$w11gD$$ Ln=FL$BD$ B$D$H D$v295v<wft딡Z 1@$G x]t&U1ɉ1V1S1ۃ 1ɋu$c=1$/H$N$ M$= ?\$D$$Z1 D$4$蘮 1U0E?b 1E  [^]11N4$>rwt$$ IQ$ I@UVS]u 9v% t# t.‰ < t< tB9ʉu[^]Ë9v8 u@[^]ɍBt&'UVS]u 9s> tB t= t= t&t3 t.t*%ut$$R9rƒ[^]Ðt&%t@릍,0U< w H]È,A<w ]HɉÈй,a<wHՍt&U8]Ӊuu}E؋\$4$E(U9w1]u}]À:E\$4$}9<>2\$4$EGE}9v]<>tvG}UЋU9@vEBU܀?>t }~EM܀8>uNU@L$$@'EU܈@$\ F1UE@BU뙸D$$ ~F1M܉UHuu }}]t$<$B9r <(tD<tqӋDPtˉ-΍E$Ut$iE9w1뱀8(u@E EEEԋM9vbڃ)Eۀ}tEЅ~OEԅthA9vay]}Ë@UAAAEMU9w]Ѕ 9v 9)$ 6E1} t3\tW(t&}UË@@E̍AE+A9ƉEv y uAEUƂ@ BUQYf b 7\(t&),0<19v=EEE‹UC}TЉU9vET,0<vE]X&E rt?tvt0neA EË@@EA C묍A ׍A ЍAɍA9y At$$ C1RU̍A$@T$5C7AYt&'U(E]] u}E$\$EB9ÉEr}vKB< tC< t>< t:< t6< t&t.t*<(t&t<[t&t<]t <%u6TuEU]u}]$) B]1u}]Ðt&U(E]] u}E\$$UU9ӉUs,E9ÉE$< B]1u}]Ëu_ ׉u;]tSUB< tH< tD< t@< t<< t8t4<(t.t&t<[t<]t<%t&u&'}M9E]u}]鐴u躆 ׉=;]tQUB< tF< tB< t>< t:< t6t&t.<(t*t<[t<]t&t<%}M9EkU]] }}u\$<$L9v8/t!$R @1]u}]Í@1`79< < < < < <(<[<]t|<%tx<#\F\\```\sB`t&`~y`1 ss$ټgkVDPtNDHXu{F$ P?F9w$( 2?$p !?1gD$$ ?kD$$\ >TXTȉ\FvUWVS,EM E]L$$ u9u bjEЋDPd-+E ހ m d [ R IA/8(t&*1EEE<>[]t&%.XыMЋDPE} G} ME؍TBЉUԍv's9u uv1H t( t# t t tɉt(t /=1R1WE,$RP,$B&.E+t{-tV$ <,1[^_]EEEɋ} 7$u,[^_]Í|B1F9E vÉEE,&F9E vÉEE &E_E蔣Hv~ D$$ <]]'U])Éu1ۉ}~)C$zr$q\$|$Ɖ$e]u}]Í'UWVS E9Љs" C9t<$D$buMڋ\U [^_] U x EU ]뎍&'U | EU ]kt&'UUM 9r]1À8@u@M ]UWVS } E|$$5U29vfC9t DAuډU [^_]Ív'UWVS } E|$$U29v:<+tZ<-tV"f C9vDAu.t)'ډU [^_]DAtC9wٍ^9ߍt&w̍UWVS E }E$ R:;}sOw29s!}9sC$ D$':9u9tE  [^_] :$:ߍw2ԍ&UxE]] }}u$\$M9e,(C9lj}bzKEU\$$EMMă9ˉMEu4$÷}}bEԉMDQ< tw< ts< to< tk< tgt&t_9E]uAMTBЉU< t:< t6< t2< t.< t&t&t"9MuDVupEE\$$M9OUԋ2DF9   v  E]EfAMTB҉U tm th tc t^ t&tUtQ9MDFut$$, 5$\$$$}EU\$$E9P8RGp9uvF@< t>< t:< t6< t2< t.t(<(t$t<[t<]t&t<%MȋẺ<$L$D$PEU2$X 4$\$$$UEuĸz[E9ÉEv UĀz =E@9v M9 = t;]v u> }[ t$<$膨$Ɖ$̛E4$褴MEU9u D$4$%@$E}<$UT$$EM<$}D$L$uu\$<$EP 9ӉUr  Ɖ׉E$EЃEEE؃ 9M؍SU9ʉMUMEM9Eu>mu溮 ׉uЋU)UMMUMU~y =ȃEKEC} $wE4$臠}Ef fEm]m>v'UWVSU}] \$<$EUB9r:[t$| 11[^_]Í[E,t&8]tNE\$<$D$ht?D$4$8\$<$E9w$ 14$1/덋U@녉4$1$ _1jv'U8Uuu }}]t$<$EUB9s1ۉ؋u]}]À:tlt$<$_t$<$Et$<$th$H g0$1 =U$$$1$ +0 $ 0$1x>uEt&'U E 1ɉL$D$E$x1҉ ÐU1t&'11ɉ@1҉DH lu]Í&'USUwXсx@;@@|L$1$  0[]Ít&RI\u$ /؉D$1$ /USEw~x:R;@@}&IBËKt(CE[]L$$ h/1[]ËCt-$CCE[]ޝT$$ ./$  /붍&'UVS1ۃt& 4$D$UtC u[^]Ë [^]É'UWVSE ]tjtfEUR@@~bZ1&F9tLD$E $TuE [^_]ø D$ $D$D D$$ $U[^_]É\$$ -뭐&UWVS] utXtTxx[@@~XZ1F9tID$E $.Tu[^_]ùH  D L$ T$D$$ fT1[^_]Ét$$ D-s USÃt,@t$Ct$լCCX[]ÍvUWVSE8E-EEUM Rɍ@Utm@Z1G9tVD$E $SuUE $p T$D$y+"USEC@UB9UZEE CCC CCt E 8UECSECUE [^_]ÿ[ D |$ t$\$$ RE$UC$4뮍XBZ[$`\$$`$g`UBE$UC$U$NS@$`$%`U T$$~11ۋ FhM95塼$V$K11ң1t$U$J1[^]ÍvUWVS E} tE$Bt $Q UGGZ(B G GZ0BB$E$ijUB\E$s$ u$= g\$4$D$臨$ K$ U =\$4$D$]G$袑$.Q \$4$D$4G$y$ B\$4$D$ G $P$ ›\$4$D$UBdt D$4$茳E$UB` [^_] Uu5}} ]9vU1ɍ$ÉDt |$$ 3t&E$D$ED$ D$Ct$$*I]u}]ÍX$S[T$$S$JS5E$D$ED$z D$Ct$$H{'UWVS,5~Y1 vGh9tDtD$E$+DuߋM SxM 9űE;Cduă,[^_]ËC@ߺT$D$E$d$oREA D$E$ EE$@DE$MBE$"D=9ËE$؋M11D$E $D$"8VEEu=~E$?bED$E$D$E$xD$$ED$ED$E$EA D$E$D$$E4$=~E$LD$:E$?EE$lD$q$eE$ D$R$FE$D$3hE$>E$[E1$E$RME侠8$AE$8D$D$P8E$A{t&E$D$=(E$aU D$X$RO[T$$]O$O `E$D$AC C|$T$$_DE$}E$N$Cu%E$D$o,[^_]$u ͋E$D$D$@8ؿ|vitn$E$D$+묋E$D$E$vEx5C C|$L$$:C$F!uUE$D$ yuSE$D$zY\C$_D$d$Y$M$S럋E$xD$ED$E$D$E$[nE$D$E$>umED$E$|$(HE$e>>E$ D$ E$EL$5At$"념UWVSӍ| 9M*&ؙC) 19}ދEZ[^_]Ðt&Uȉ]É'US]~ 1[]Í\$$>@ 1[]Ít&UWVSUE;Ed4ZE&4CEu,9E.uCEtԋM~n9EU *t&C9ˍ4t<9EuCЉ9ˍ4uύt&'U })D0U[^_]Z;u~1 ͉9Et2tTMCU)D$w$1[^_]$8뤐UWVS t1ۍ'C<$o:9u [^_]Ít&'UVSÃ@1ED$]ȉ$ ‰xi$ s_ 11RP,$M }E% fEmm}]EEf fEm}mދEЃ@[^]؉\$$UV1S ML$ L$T$$Z$Ht#A D$$;w$H$q= [^]UT$D$ $誌Ð&UWVS E$Wu 1 [^_]ËU$WM\$ $0UE$ݝ8"VU$,U1ɉXTx$=X0t,t݅8w'D$ FD$D$$ -9 10݅8$‰Ë0|41D$1$1D$5<訂1RP 1P,$ܵ8ݝ@ݕݕݝ 4$7==+|| 4$||4$z4 $x{4$V|4$H|4 $8|Ƌ4${4${xЈw ,<}E% fEmۅ 11ɉT$$L$7~59~Ƌ  )1U9d~S~O~ ` w  E-$\؋9~,~(\N99$@$5 EI \8Qf8D$8D$ $`$@$5\ TXX4]\݅hݜ$肞4$HP\$$D$b\ $脊0$xL$ $~ P4륋4$s4 $sË4$u4$s4 $s4$s4$u4 $u|D0F0$0D$T$8L$$8D$)4Y41ۉ $l Ct2,<t뀼+uዕ0\$$T$1ŋM $P(P$萜$R(\$$D$lP $莈yRz$$D$H$+ $D$0$9 \$1ۉ4$D$$h Ƅt$1D$($ސyLǸHYXXËtx9H~H9L}L$M<$D$Ct`,<t@9tS$$y<$D$JTmÉD$D$$8828eL9HT9X+x݅$ y$D$~݅$x$D$~݅$x$D$~݅$x$D$s~$dP '\$1ۉD$($?:x,$xx4$D$,~HC 9L|4,H؀<u1$D$4x4$D$}뺉4$1̙$莂\$D$($討4$1΅w݅@ ݕ $w$D$}1$D$w$D$c}1$D$w$D$E}݅ $ww$D$+}$|$[w$D$}$t$?w$D$|$Q 见\$D$($ۅH$w$u(\$$D$菍ۅL$v$C(\$ $D$]TT,$L$g/10$T$L$O4$=n4$}n4 $fn4$Rn4$Dn4 $6n4$"n4$n4 $mY4$Km‹4.)4 $o‹4 4$[n‹44$+m‹444 $>)Y$`ȉʃ9d$[8$7L$1D$4$,11t&G9 ʃ)‹`uC9u\1ۋ1D$4$T$N,넉1҉ )Y`wdE苍`$g9lj~1)ʅtLH))d`E$E)D)q$jkj}$= \}\$4$D$|$K @}|$4$D$`4$X$jk}(\$$D$44$\O1҉)$ c($r($_4$i‹440\$$HD$$|Љ dD$$T$LH$D$T$<$Nt&U(]]u}$C|$$A$]xBt"؍&']u}]EsЋ 1$‰gtÉ$[bt$$oE1x<$)<$(t$$D$$T1wUWVSӃ<|$T$$t%ED$ED$ ED$\$4$9u%1\$$lN<[^_]Ít&o\$4$}<t^<0E@P$$o<$D$uE@P$$o<$D$eu<[^_]ËE@P$$o<$D$9uE@P$$co<$D$uE@P$$Ao<$D$tE@P$$o<$D$tE@P$$n<$D$tE@%D$$<$1|M1ۍt&#tT$$C9]mEuS$U$nn<$D$"tE$Wn<$D$ t봉'UVSEwݝhEEE ݝ`E(ݝXE0ݝPE8ݝHE@ݝ@EHݝ8݅`܅X]݅P܅H]݅@܅8U݅HݝxE܍8ܭxݝx݅X]E܍8m]݅XME܍H]݅`܍x]݅PMm]݅@ME]E0 EE ݅h]]kvl}E% fEmE5R R m]E R $l$D$8r}E% fEm8 m]E R $Al$D$q}E% fEmE5R R m]E R $k$D$q$]v\$4$D$}w݅hic݅8Mm݅HME܍x݅P]E܍@Eu]݅XMe܍`EM]E]݅@Eu]e݅`܍P]EMEu]j}E% fEm݅`MR R m]E R $j$D$hp}E% fEm݅XMR R m]E R $^j$D$p}E% fEmEMR R m]E R $ j$D$o}E% fEm݅PMR R m]E R $i$D$io}E% fEm݅HMR R m]E R $_i$D$o}E% fEmEMR R m]E R $ i$D$n}E% fEm݅@MR R m]E R $h$D$jn}E% fEm݅8MR R m]E R $`h$D$n}E% fEmEMR R m]E R $ h$D$m$!Q ur\$4$D$~v؍&'[^]Ít&݅hٞzt}E% fEmR R m]E R $jg$b( @&fR ܽhR U}E% fEmm]E R $f$D$l}E% fEmEm]E R $f$D$el}E% fEmEm]E R $qf$D$%l$p\$4$D$|\$1$^Y$1GBUuƸ]ӉD$T$4$舉u1ۉ؋u]]ÍED$$ED$ EȉD$EЉD$E؉D$ED$ED$ ED$\$4$tEٞZ0 EDEٞ2Eٞ EٞEٞEٞED$\$4$腈ED$\$4$ E ]E\$@E\$8E\$0E\$(E\$ E\$E\$E\$E$qd$&n$D$it$$iCt&ظ1ۉD$$ 7 EE?H1\$D$$  UXT$]u3333}Q?$33?T$@3333|$D33?t$83333L$<33?T$0Q|$4?Ét$({GL$,z?T$ u|$$V?t$c]܉L$F?T$@|$t$1L$ $T$tbv|$4$h]u}]øuLt$&/m4$D$ch뺐$-m4$D$Hh럍U8L$]ӉuƉT$$u 1]u]ÍED$ED$ED$ ED$\$4$#tȉ\$4$蓆E҃$D$ED$ocxED$ED$E$Bs$rgft&'UWVST$$EE U9$`E$Y$5k$= k\$4$D$w$ k$ U k\$4$D$wE 1RP,$$`$.Q jk\$4$D$wE1RP,$$`$ B7k\$4$D$Ww$ k$77  k\$4$D$-w @L$$h`$ j\$4$D$vUE ‰E$$$n#}Etm}$P ?M $mE$Y#$IEE[^_]ËE M9U\$$, NjE1҅t' W:DWM B9UuE UUT$ML$E$gU$"$E[^_]ËEt=1\$4$D$CUG9}uՋM UIut&UW1V1S,] T$$1D$ |$t$$>E$ EE\$$pvED$E$ΠED$E$܂+ED$E$d,ED$E$l0ED$E$t*ED$E$4ED$E$$*8u]uFR\$4$8<?<D$\$4$-E1҉$ED$E$kED$E$)$E\$U4t41RP,$=@ ݝl8t81RP,$=@ ݝtE䋕00*\`,$X $U}䉕D Ë0$T $Ƌ0t1&'@90uDt$ $4$$u]D$t$$H1ۀ++$H U؋]ԉ@KډȉI҉E@Db $$1D$E$觏EtED$E$^|Et11D$E|$$PTT$D$E$1,[^_]ùL$$p Ut1D$1D$E$붍EԉD$t$$rEԃt&&D$D$$l OE$ƅ*t$11ɉD$?~D$fEfEfEfEƅ~\$L$ T$4$D$$ ]u|$\$4$K|EԉD$ E܉D$\$4$y,X$%7 b$D$^T$\$4${ډq D$ $]EHP$$XD$$]Eԍ@$$ƋEԅ~111ҋEA2EDD2EDD2E9Ӎ@D$4$c4$$\$$0]D$ED$E$zzUEu$\1$d$77 naT$ $D$mU䋅0‹ $T$D$Z^ $$$t$D$$<$5dEL$D$E$yIUEZb$`1$d\$$ 1ɉ$>1$u]D$t$$&yt(1D$EԉD$ E؉D$t$$bD$$ ubED$EԉD$ E؉D$\$4$?t??o$1$ X_Å$ B_\$D$$\ku]D$t$$,x3$ ^LUERC<$u$c^\$ $D$j<$b$ ^5$d^|$$D$jlUEYUEC+UE +t $ UEUEf+t $ [0UEL$,L$M $ p/+t $ 0UEL$,L$M $ )P$ >]$ +]$-7 ]$ D$\$4$vډED$$ED$ ED$ED$ED$ED$ED$ EȉD$t$$yEٞ0 EEٞEٞEٞEٞEٞED$t$$tEE?E1\$@E\$8E\$0E\$(E\$ E\$E\$E\$E$sP$-`[$D$V\$ $|V&ډp$O$H,Ƌ0ȉ $L=$$5HZ$= Z\$4$D$f$ Z$ U Z\$4$D$f,1RP,$$O$.Q eZ\$4$D$f01RP,$$O$ B/Z\$4$D$Of$ Z$77 Z\$4$D$%f @$D$`O$ Y\$4$D$eLt,1ҋ  ;M}EH B9Lu֋LH<$D$T$VH $B$2ظD$$ 5$-7 -Y~ED$t$$w9E w ]+\$D$$ vUS$]$\$ ]D$D$$1҃t$[]ø$D$mg1҅ƒ$[]ÐU8uu]] }9w;tB nd L$ T$D$$ B9Ӊv: uBv'\$4$p9Ӊv <%Eu%B9Ӊv< t< u1]u}]À}>`(}/B}<I}(t&m}t}f}n}+}-UDP}.9}<[<]<{<}tN<%tH< tD< t@< t&t8< t4< t0t&t(B9t#<(tt<[t&t<]t<{u)Ǎ@}Ud}]}[E>#B9v z>6$ >1E$i$Ë|$$D$UEu] }E]]\$4$: b}{Q}}& $v$SU@D$$)\$4$\$4$B9yR@>@D$$r\$4$i aTUSÃ$ $S Z[]Í'USÃ$ $# Y[]Í'U$ $ UU PÉ'U$D$ÍvU$]u։}1 $ É0@u؋u]}]É4$ $k Ctډt$|$$LȉU8uu]] }B9s2<(U:(t#1D$$]u}]1B1EƅE9vXP~FP(Ui  {=G맍)WE<<Zz~BU:<"z<9ÉE1E$\$2kE>@E‰$Dh6U$\$jU >I9 ABU<>j)tD\ED$E\$$Xi}o=Gb(L)=G=9v x  =G BE$>g A;]쉍v U E1@$ D$$ Z1yUBUE^1҉E@$ D$61Y UU]u}1҉E8/t]Ћu}]@1ۍpEM;M (z/tuti[td]t^{tY}tT%tN tI tD t> t9 t4҉t.A#E~GC$@ X&\UE$$<4$J@$$!t$$;\$$$ 떍A9E nE$we~M$d t&'UWVSE$D@$$}ljE1ۍ&'E,!<]wb#t](tX/t&tOtE[t?]t:{t5}t/%t* t% t t t tt E@EE#@EED$‰$dC9jE[^_]$ $~-$ljEt&'U]]uD$$($n]9Ƌu]Ít&UWVS,*1D$ D$ED$U$?Nj].eEE;9] v(vj/a<X>t&J[A]8{t&*}!% t&    t& G"v#KMCBuAt&t9[t4]t/{t)}t$%t t t t t U $D$+1E|$D$U$6]U;U t[<(tTtH<[tD<]t><{t:<}t6<%t&t.< t*< t&< t&t< t< tt&uN&'E$$ED$$b,[^_]Ä 1,[^_]ÍU$D$$,[^_]ÍUE]U u}EU˃9ӉMv]1u}]úTΉ׉u;]tPUB<(tEt9<[t&t0<]t,<{t(<}t&t <%t< t< t&t< t < t< t&u%M]E uE}]ItYU(E]U u}EUK9щMwy_ uhE9E|C<(ttth<[td<]t^<{tZ<}tV<%t&tN< tJ< tF< t&t>< t:< t6t&t.&'C9EEsB]1u}]ÍMU >]Eu}E ]S މuE9EtJC<(tB<t6<[t0<]t,<{t(<}t&t <%t< t< t&t< t < t< t&uM1U ltAUEQvL$$ 1Ð$@t&@Ë@u۸  D$ jD$L$$[ ?&@uT$ B@u3D$ +@tK$4 1øWD$ sD$ D$$[ D$ ׸E D$ L$T$$[ &UEtcQvL$$ Y1Ðt&$@$4 =1Ë@Eu@tMË@t2EX#D$ D$ D$$[ 1D$ ׹Az L$ T$D$$[ UEtøS D$ L$T$$[ &U8uu]}Bv!T$1$ :؋u]}]$dF1ۉ$_~׍@$$.ËF|$$D$;멋Fs8$$fals@e@lFF u\$4$D$I$9$t$É$$F5uD$\$4$붋v@$$IVËT$$D$*v$2@$$ Ë$D$!$4 1w$e$true@RkT$ D$ D$$[ muD$ Q׸ D$ |$t$$[ 6D$ i령 L$ T$D$$[ &U]]u Bv/T$$ $]uE]$CuϋCv$$믋Cu练 \$ L$T$$[ HCuD$ D$ D$$[ sFt$H$84$8$(st?uܸ_D$ 둸o D$ :D$t$$[ D$ HW t$ \$L$$[ ct&'U‰VS0tO@EƋƍEt$$t;ut $d $X$] E0[^]ûY \$ L$T$$[ UMBvT$$ 1Ð$$4 }1ËAËAt{ËAt`}Ef fEm]mEËA$ "1øD$ D$ D$$[ D$ ׸D$ ǸA D$ L$T$$[ UU} AvL$$ Ð$$4 mËBfP$ËBtvËBtDËB$ &ù L$ T$D$$[ T$ D$ D$$[  D$ D$L$$[ D$ H밐US]U HxE1ɍD&AH9u[]UWVS t@tQN~xV11ۍt&'Dt$p$`NVG9ى$Q$AFt$:$*4$*$ [^_]ËV뼐t&US]t"C tF$EY[]vZ[]ÍUWVS,MEP $}2Uz EܸD$$D$D$G $D$zG vv'҃w$D$t$=1G vBwL$T$$T$W ) T$$\$L$M܉ $:OG X EEGUt)‰)ЍXWEЋt$MGD$D$RL$\$4$7T$MWT $T$D$D$E܉$(9GUOt EE;M(G  ɉEEE]v@ 1ۉT$D$E܉$8UGD$f$VGM\UOT UEE;MCGUtEWEЋPuMRp @$D$^)ޅ~XUD$ ~D$D$$|btD$)މD$M܉ $7G2EUL$ƒ))Ӊ\$M܉ $7],E܉$=$7 EE܃,[^_]øD$ D$D$$" EM܉ $'E${/$<9\$4$D$ FE܃,[^_]ËU܉$'=$KEa U]u}UuEE]u}]ÍvP҉U~ۋXEEE9Et}u뷍v'USEt2X t+U qxDSЀC @fC 1[]Ðt&D$ \$L$$"a}[]Ít&'USEU t&t"X 1҅x ST[]øD$ HD$D$$DUuu]E t>t:D$4$zt\$$؋u]]$Q莻ظZD$T$ D$$Dmt&USEU t&t"X 1҅x ST []ø 4D$ \$L$$D UWVS}EE $D$UB ta$u$ƋEp ${$U$&UfF$ &UfF$%UfF$%fF F$ $qFF$$Tf~FE1'U$#VѺ&JuFUË$#UCFË$#UJȋNCˉ$m#1҉C FT8UFBFU9dfF 1[^_]þkt$ \$L$$j5'UWVSE@ U ExEE]ME9Eys6M11)΍M C)BE9uEUMT1҉TUL8 T8[^_]ËEp^fX@4$\$$$oMU uANj76 D$ |$t$$QUWVS,]|$1*$$Ɖ$!E$!Í@D$$$(#É]\$$b$#E$F!Ë$"E$"UЁtnfst#Gf9}sÉ4$1y$i,[^_]ÉD$$E 9E||1 $v"$l"$ Nj$ 9E tCf9]sNj$UFF DF,[^_]ÉD$$uo/^t$ \$L$$ Q'UVSu4$m$$A0É4$=tN=OTTOt8=fcttuC&$C C[^]C֍CǸ:D$ .D$D$$ U1]É'U1]É'U1]É'U1]É'USË9sx t t[]@9u&U(E ]]uu}]É\$1ۉ4$tÀ/tDG u`1ۉ,+`FC9Xv$~>t/tPыDP t1ۈ`g9X[>t/tPыDP 89Xv+PDC u DC t A;Xu1(9X„(P DA XDA C9u(DA tXDA pF9uft&DG tF9Xw@8et>/t69Xt>>t\E 0((tˋ] 3F9XvP F9Xv DB u8`t`,A<w QAuU F`Fu9Gu:a8<8UJD$$v(4$W] ;SWPDA u@DA 0E B9Pw ,X844L$$$á1t1}D$D$\$ <$Lu1$$$@$f$\$$1{9|:a}:b~:c841E(1߉@,a<v,A<v,0< v -t:uG@9Xw̋@@@$x$\$<uX9t:uF$$t$Nj\<$D$7wM Y뎋Et=D$$;R} G $)ȉD$R_E L1[^_]}U؍]]U]]G]$艁D$$;TRE @ $)ȉD$>R]G]$GM E YL1[^_]ÉU1VS] 01u,1C$D$-C9$D$ ;$設,1 D$$t$01$$1[^]ø D$$ٞuǾt$$ĞuL$$诞u릐"D$4$V럸#D$\$4$V$苫${p"D$4$VU&'UVSXu$411ɉD$E L$ \$4$D$=x\݅pU݅xUEUEUENE]N]ݙEȉ$B1ҁ[^]Ít&U҉]Ӊuu]u]É$m\$D$F$tҋ@҉'UWVS] C$D$+C$D$8}<$;CrI 1[xwUB\$|$\$$ 4$ө$Þ1Č[^_]ËU1D$1D$ \$|$$?<y4$蓩$胞뻍t&1D$1D$4$LVm@#D$Et$$|T믋ET$$fTcU]] u1C$D$P*C9r4$a8]1u]Ðt&1ɉL$D$$NAtω$Pt‰4$11뵍&'UWVSu F4$D$)F4$D$C7``$[1D$1D$ t$\$E$:xZEttEEzEEڞؾ#t$E$S<$֧$ƜĬ[^_]݅`zt݅p݅h۞u zE]]]EEЉD$E@\$ <$\$=xa$O<$D$Q<$0$ Ĭ1[^_]]]]]뚸l#D$E$%R"<$ަ$Λ\$E$Q'U5p %1Í&US 1Et&$dQá 1$1 1[]ú#T$$pQ&'UuΉ] xR^t5T$$?Ått$t$$.؋u]]É1ɉL$T$$N>1t$T$$8>uÉ؋]]Ív'UVS 1u] uJC$D$&S,1; 1th$u3 1uE [^]OP#D$4$^P[^]øD$1ۉD$4$?P 1$ 1̸$D$4$P빍&U8}}uu]<$P u]u}]ÐxFtE $vt1뼋$谍Fr<$:E $1҉tbD$F$$$<$\$$F$;w1G+L$ T$D$$;E t$L$$E $kt$T$$R+D$ D$D$$&ҔE $ov E D$|nE cE $ EE $bUƅƅET$E썅EED$ED$ ED$$W}Ku\$)D$E $1R+D$ D$D$$͓$l$kQR+t$ \$L$$蕓R+D$ D$|$$nU1XD$ E }}uuЉ]D$t$<$B@t Gt$<$L؋u]}]É4$tiUE1ÐU1xuu }}D$ EЉ]t$D$<$?u\;Fr5EЍuD$4$cEЉ$4$EЉ$4v1t$uD$ t$<$w?taD$<$K؋u]}]U1҉xuu EЉ}}]T$ t$D$<$"?u\;Fr6EЍuD$4$EЉD$4$d4$EЉ$01t$uD$ t$<$>taD$<$K؋u]}]U]J&U]J&UWVS] C$D$ 1҉|8@`E$1ED$ED$ E\$D$E$1C1$D$ |$C$D$/$C1$D$R C9,]<$t$\$$KEK|tz$"$芞XD$ |$臑D$|D$(1$T$FD$|$:H|$L$<<$1Ĝ[^_]ËC$D$,|¸ 1nw|D$$D$E$I|$ڝ$ʒ1҉T$D$$9.$7$L$E$H4$E@\$ED$\$$ $L$E$uH<$|GĜ[^_]ø$D$E$;H$t$E$"H|t%D$눐&US] C9s)ЉD$$BC1[]ÉUS] C9s)ЉD$$BC1[]ÉUS] C$D$C$D$+t"$E$2$"1[]ÉE1[]ÍvUWVSu F4$D$EF4$D$*EU$JYF4$D$1D$F4$D$",E$tQE,&UL$D$$F}<$E$B$2[^_]Ë}<$toE$$EUD$%D$$F뒋U$o%}D$E|$$EY$1|$$>}<$$D$F;w$8D$$F4$D$F9s1|$D$4$*u1u tU$1ۉT$P D$E\$$/U%}D$T$<$DkE~L$$DkU`%}D$T$<$DE$z$j3}@%ET$|$$}D<$E$5&U(E]] u}tmtiUtb$D$ƋE$#$y td$ltwp |$t$$1]u}]ø_+D$ D$|$$;v$4$U\$$D$1렉$4$e\$D$E$1tt$$l&aZU(uu}}]tGE t@t<4$<$ÉD$tI\$$&a]1u}]Ívn+t$ \$L$$AE $4$\$<$D$렉UVS@] uC$D$;CUȍEU]]]F8 ]8q8 D$$8$8ƀ8 ƀ8cƀ8mƀ8 D$6<C$)ЉD$#<D$$ 4$$1]u}]û '\$<$@۹4'L$<$?4$貔$袉볍vUWVSu F4$D$8@F4$D$8#P$P1D$1D$ Et$\$$&GEt EE]@1D$E]$_EEE]EE]E]E]؋F4$D$ 8<=É<$A\$$$2 1UT$ t$<$D$YP<$a$Q1ļ[^_]EEUE@݅`]݅P]܍X]CV,1KD$E$><$ڒ$ʇq$<$D$4Q\$<$<Ed'T$$=.'D$E$=델'D$E$=UWVS} G<$D$B;Gs :[EG<$D$\1D$G<$D$w"$u$$}Ef fEm]mu1$19fW,1$1a)F9|?~Í&C(9|E<$D$31[^_]Í&떉Ív'KZ&9|čBEz-t*$(~E\$$<뙍BEE't$$;hEL$$;J'UWVSu }F4$D$1҉L8@P$N1D$1D$ t$\$<$"Et EV,1$I1]GD$E]$[EEEL]EE]E]E]$D$L$^9)UT$\$$+L$9L$J$:$1[^_]ELUEG݅`]݅P]܍X]RU\$T$$+뎋F4$D$LF4$D$Kd(D$<$9LtL$~$n$,@(T$<$9Lu%'\$<$^9LtۋL$$ÍU 1t$(W 1$X1ɣ$1(1 1t&T$$(1$蟍$菂1(141t$11 41ÍvU1S1ۃ 1$1$躍$"(1$%41a $C7D$41$f+uۃ[]ÐUSË9sx t t[]@9u&U]@1YÉ'UE]ÍvUEt(E t!?1ң1 ø/D$ D$+D$$k.}t&UEt%E t11ң1 ø/D$ D$+D$$k.}&U(}}]utu t]u'/.+L$ T$D$$O=}EPUH;JMru1MA $D$aEtFu|1t&M / $\$r|F uܻ}<$ $؋u]}]û{.Ɖ߉rUEbu. lE1ۋU@ .{.B`" PM $胊$sr}EU_ 1{.$/BW^2'UWVSEEËE ÉڍE0EP9ӉUw\1U1\$$t9u_1t& /$D$%{tjF u1$ɉ$~[^_]ú{.ƉuEE. u$y$i~뮾뗐&USÃ@t$H$8~CCC C CCX[]ÉU1ÍU~+D$$3b1Í&'U~,D$$3"1Í&'UEt#U t0,$T${3Ít&/+D$ D$L$$k.y'USM] tptlS 1?C$D$t*11ɉD$L$$x$蟇$|1[]ø/D$+T$ D$$k. y&U8E$]E]qff?$ffffD$VE$VEvV 1D$1D$ ED$$]T$qD$$.;,1Í&Ew$pE1D$1] .D$ ED$$]dT$p농UWVSElݝpEٞ }R $yL$<$}Ef fEm]mut$b{t(7 T$$t$Rh}E% fEmV$ 5 R ۽xm$7 $= |\$4$D$lۭx]E $$Eu6\$4$D$V4$N|$$7 D$:N4$b.u|$L$4$BzÍ݅p.T$\$$"z4$D$ *Ĝ1[^_]؍u1ۉ뾍v$T$.\$4$D$|$$u[&Utu61D$$SlÅu Qt&1D$$f^l1D$$bJlÐ&UWVSEuݝp@@ ]F f(EF EF(| xE}E% fEmm]E E!E!xtHGU/E] xu0t&1[^_]g]]E xtq|EE?EEU]]@E$]WxEuaD$0E\$4E\$(\$ F\$F\$F\$$ZeUxn"4E1\$E$݅p\$E$xb]]UWVS|EUV]@@ ]EF@ɍH/)BA&'E!ǃ FU<E] vpEEE?EEU]]@E$]NUEF@\$$^N~11ۍ&'VC@\$$]9^ߋU%l$Ef]]E *|1[^_] ]]E1\$E$AE\$E$z]]떍t&'US4EtBU t;=~Y]U11ɉD$ڸ$4[]Ít&S0+D$ \$L$$k.qT,$T$h*뷐US4EtBU t;=~Y]UE1ɉډL$$'4[]Ðg0D$ D$+D$$k.qpT,$\$)뺐U1?1ɣ11ң111  u1kw|,D$$a)11 Ðt&UWVSu 蟹VEC$Ժ<$ \$D$E$'<$}$rVF9D$4$6 V;Fs8=uV@F9D$4$E$Gp@D$E$/<$U\$D$E$rE$}$r3Mt,$ T$D$E$!u u4[^_]É<$|$qE$([^_]蹭w¸,D$E$'1륍&U(E]] u}titeUt^$.O E$购u}$.³uFE1]u}]ÿ0+|$ t$\$$.m&u U1$,fE.u-E1sU$4-T$+EVD$$-E<&UVS u] tntjS C$D$!tr11L$$t$k]?$=/Mz$o1 [^]Í&0D$ D$+D$$k.Al.D$4$%볐UWVSLEu V1UF9+D$4$N31D$1D$$j$\Gz$nVu 9E] /ME]]1EMU[L[^_]Ðt&{0D$ D$+D$$k.k $-y\$$Ay$x4E-L$$+$tEh-T$$ $VvUVS@u] SC$D$tc11ɉD$L$$gi$]tx$dm=~a]UڸE$}@[^]Í]뽸?0D$ 1D$+D$$k.iT,T$4$!#뭍v'UVS@u] SC$D$tc11T$D$$wh$]Ѐu׀w$pl=~]]UڸE$@[^]É]+0M+t$ \$L$$k.hT,D$4$1"뱍v'UWVSu] ~SC$D$A11D$|$$g$ݝxv$yk=M؉U= H]@BAvEEEEUE] t&'dEEE?EE$U]E]E]J}s@\$$S@@ R \$@ R $`RHH~|& F@@ R \$(@ R \$ T$T$@ R \$@ R $OH9Ћ@\$$QEA`Zݝx1F0D$ iD$+D$$k.e%]]E `1Ĭ[^_]] ]E1\$E$qn݅x\$E$WL]-\$4$UWVSEu )!V1rF9/D$4$i411L$D$$d$\Gs$hVuE]]Y/ݕxM]E]:ܽxM]E]#ܽxM]E] EUܽxE]/E]M]ED$1ډD$$Č[^_]ø0D$ D$+D$$k.cE.T$$B본-D$E$'UWVSEu &V1F9,D$4$11D$1D$$sb$\G~q$nfV|uE]]/ݕxM]E]ܽxM]E]ܽxM]E]lEUܽxE]/E]M]E1ɉD$1ډD$$Č[^_]ø/D$ D$+D$$k.AbEH.L$$볋E$.T$$또USË9sx t t[]@9u&UWVSuUEVM~wF;vp1C11T$D$$`EG$o$dVk9}t&F9sD$4$u'[^_]1USÃ$E]E ]E($(`]E($dEME[E[EM[E[ E[($[]Í'UWV4SE؃LUEB$D$11D$|$4$_4$]n$c}G<$D$EtOE$~a]ȋE1uFD؅tU$T$_uw#$31]EME L[^_]ËEؚ U\$D$$6}<$m$b붋u_ \E@ٞuXzV]ȃEBh3ME$Z$5D$E|$$~IS@C$D$MS:&5D$E$$h$]1ƅ'q0t=U Bht4E@6\$$1ɺ?14Gt0 4!<1ɉI0 8 4 41D5t$|$1ƅ' E \$UD$$E HhsE \$ӋC$D$1D$1D$4$HX4$ݝ(Rg$B\݅(ݝ1C$D$711T$D$4$W4$ݝf$[0룋C$D$L1D$1D$4$Wz?E Hh4$f$y[IEME$>Hٽ^E^f f\E٭\٭^U JhC$D$+11L$D$4$V4$ 5@ ݝe$Z8C$D$11D$1D$4$vV4$ݝ(e$pZ45MEȺ$5E EXHEЃHhXPEXXEX`U Jh4$e$ ZU Bht6D$E$1(?,11D$1D$$UE Hh53XSG$d$yY1D$1D$$JUE HhX`뵋1D$1D$$$UE Hh531D$1D$$T 5@ ݝHY1D$1D$$TE HhXH011|$t$$TE HhXP11ɉT$L$$vTE HhXX1D$1D$$MTݝ1D$1D$$(Tݝ@1D$1D$$TU Jhl11|$t$$SU JhZC11҉L$T$$S5ݝ1D$1D$$S5ݝP1ƅ'1S@U bhU EFC9]v@O ыDP@uك:'o9D$h|$$Nƃ>~E1;E܈5hs<~Ft&.hH;uh1T$$v9"];]r5hF>FC9]v@\N ыDP@uك:'o9D$h|$$Mƃ>~E1;E܈5hs<~F.hH;uhD$$8!t&'\[^_]ø\E9Es܉D$E؉$=E;Es$ 9!E܉D$E؉$륉Ӊ\$$mU؍ET$$U\t|$D$$8M!\$$8E\$E\$/!v'UV1S@:t(1ۍt&'H:tЉƋ\:uDt $DІ[^]Í&US DuB|1ңD@:t%1ې&D:tЉ‹\:u[]ø;D$`8T$ D$$9.HU$D. |DÉUS]$6I\$D$D$[]ÍvU]] uutEuA$艇 tv\$ 4$Ht$D$D$3t ]u]Í4$Ht$D$D$賁tωE]u]\$ 4$jHt$D$D$}뛍t&'U$1Ív'U$1Ív'U51ÍUE $*1ÍU(EED$E $`D$E$`q UWVSLD]Ez1۸9ut&F@;tD$$Eu v~$/GEvD9u3Ks,0< wڍ'JB,0< vEĉ\$D$E$ƅL[^_]$9E1D$EEE$]C E }E% fEmm]E${$( $花`$ $oE$ $T*$4 $9}$%$ $ o$ \EE21D$E؉$] E }E% fEmm11D$ 4$D$|$6E$<\$$P9/~;D$`8T$ D$$9CvUWVS<=Du1tI91&C@;tD$4$Bu v 4$oDt$<$D$|<[^_]$:1ۍEEE\$$] E }E% fEmm]E$蓍EE莾1ɍE؉L$$]z E }E% fEmm$ N"$t&$4 /$ $  $( l;`8D$ |$t$$9AUx]Ðt&U]@@@@ É'UVSt$O$DVtIF~fV1ۍ't$O$qDVC9^$hO$XDFt$QO$AD[^]t @;t8$@ƀ|\u'N)~UMD$$L$NuG9}1U}[!^_]ÉD$$;51EĐ&UWVS=hE~1d1F9tU$T$_>u t95d"<M $?@$:M$LUT$$B\$$E=xM $x>GG Et&'M.EtA FtDB u1ۍv'DB u C3uC$bL$K\$t$E$?EG 9G}=xHWGMG KXG_ $K\$$K$cK=xG~UM$\<T$L$뜋G$K$%KOɉG~1҉'BO9=xcE$=yhBh[^_]ÍXdt$J\$$J$J=hdL$$<D$녋$4<D$vt&UWVSEFtDB uDB uFuE $D$E:ul9p=p` 1fG@=uF^tMCt DB uE;:1]D$ 1D$ED$$;U9ӉUȉ ;]ыDP :T_]11ɉD$ EL$D$C$);=U9ӉUt]ЋDP 9)U=n9J]f<_]܍_fxux}f0FE9~ދ]M CDB u:@_t&1EU$L>T$] \$Uԋ$>D$gX`l $F\$$F$F`EЅUԋ]ЋM̋BE؉$t=xi\$1$; $0?$;=`C0$;D$}duʼnL$t$$l=Eȉu܋MȉMjU?D$ D$>D$$;Y7$?bM L$]ԋ$>D$DU$=D$)fp@UУpL$ t$E$>D$0U$=D$t$$=t$$@='USE] uY1[]dxtd DD Y[]Ëd 搐U]@L@@P@@<@H@D@@@T@X@\@`@l@h@dÍUSË9~[]@9C)P獶UWVSEKx9xߋ9|-@9ƍL'9@9~KuZ[^_]ËUBXZ[^_]ÍU]Ðt&USIxD1ɐAH9u[]U1S]D$D$$T$Bt$B$7[]1L$D$$T$B1tӉ$B$7[]ÍUVSH 1u5'v0F95Ã0Ӆtt$*B$7Ct$B$7Ct$A$6C t$A$6Ct$A$6C$R[(Ct$A$6C$A$6%t&[(Ct$nA$^6Ct$WA$G6C릡$9A$)6[^]Ív'USÃ@Lt$A$5CLCTt$@$5CTCdt$@$5CdCht$@$5ChClt$@$x5ClCPt$j@$Z5CPCXt$L@$<5CXC\t$.@$5C\C`t$@$5C`[[]Í'US]x;r\$$e?z [| []Í'US]x;r\$$e?* [D[]Ít&US]x;r\$$e? [D D  []Ð&U]]uu }xG;s?=[9s;s~9t$$}?w 1ҋC u]}]É\$$e?P 믋C$t*vt C(x맋C(ryt$$}?Սv'UWVS }xr;=sj|,tiE11 t&C9]t2M  <$D$9|U C<$D$9]u΃ [^_]É|$$e?^넋EEtA11ۍ&'U ZTZC<$ ЉD$b;]uۃ [^_]à 1[^_]Ðt&UE D$E$(P$ D É'U]]uu }xG;s?[9s;s~:t$$}?1ҋCu]}]Ív\$$e?`믋C$t*vt 뿋C(x릋C(yt$$}? Սv'UWVS }xr;=sj|,tiE11 t&C9]t2M  <$D$9|U C<$D$9]u΃ [^_]É|$$e?n넋EEtA11ۍ&'U ZTZC<$ ЉD$b;]uۃ [^_]à 1[^_]Ðt&UE D$E$(P$ D É'U]]uu }xG;s?[9s;s~:t$$}?1ҋCu]}]Ív\$$e?p믋C$t*vt 뿋C(x릋C(yt$$}?Սv'UWVS }xU;=sM|,tLE11ۍM  C<$D$9]u [^_]É|$$e?롋EEt>11ۍt&'U ZTZC<$ ЉD$;]uۃ [^_]à 1[^_]Ðt&UE D$E$HP$ D É'UWVSz EBLp'EE~t$(9$8UBËGLPu~-þt&'GLTF;u~UBU Ev@GLU@B[^_]$?9ETƍUWVS ҉E~1ۍv'<$(mUC9u [^_]Í&'UWVS|Ex<$6n & E<$n<$En<$EnU9ЉE7<$m<$Em<$Em<$Em<$Em<$Em<$Em<$EmME9x]Uu؃)EUEUEUEUЋU ? 69t@D$\$$H@9x-$?zu]|pXEHE  EU)ЃtN$6$T6UtE؋E)B~r<$jtDC9uEHEE$6$5|G$c6$5G$L6$5_OƉG 1&=uE;EEUd}E쉕tUplh}UE)tp<`d<ld9hd}9}ds|UEĬ[^_]$45$4E1t&=uE~"1<$Fj<$jUԉE9H|B$$ 4$.4Ë|fCX($4$4M1҉ƉC'Qfu|1} BBB B,:U@E<$i<$EiE$?mu]$?6M7T$D$$$@$3$23UE$3$ 3UhE$z3$2UlE$O3$2UpET|B$$ 3$~2Ë|fX($2$Z2Cf@$2$72CfLv'UWVS=t<511C9t)@0D$E$G#u݁[^_]ø.D$U$&?މ11D$D$}<$C$u1I ÿt4$z1$j&X A D$$ `H t+& =~\$$aU $1$%H $ 3B9@؃L@@@ @@@@@ @$@(@,HL2H$t^u[4$#@$0$/t$@$%C[^_]ø?މ]$"$0$v/\$Ɖ$%4$x".ofm@1D$D$4$EA$-/ÿ$u C9sá$ /[T$$/$. $@E]H<$cE<$cE<$cE<$~cE<$scU9ЉEnH$WcHE$FcHE $5cHE$$cE$cE$cE$cE$bE$bEE'E}]MhEl}U`Ed}XE\}PT}9$@A2ED$$@MEEU)@p@EEVEUE)@E$q-$,LMBE$M-$,LUAE$)-$,L$C E}11ɋE1ۋU䉽@L_<$`]̅ۉ1ۋHC$`U9wЃ9xt9| ~N]܉1ɋE@]䉅<8@AD<D8D9uы F9|xt9DHt$lAk4MK`Tl‹X)h‹P^dT؋\Xp9U$?T$u$@t$$ AT$D$$@y$c)$(UH,Ed$4)$(UH0E5{$)$m(UH4EA$($:(UHE1|$\$E$:$(E$?D$p11$Z($'E܉$G($'E$4($'EE܉GËH$]HE$[HE $[H$[9puH<$'\Eĉ<$\Eȉ<$\ME̋Eĉ<$)D$)M T$D$U$8$&t.c$AqhH$\5M$?L$F'UVS]u t~tx{t $(BD$$($Z$ZxH9v $A D$$(E[^]Zt&$Aw UWVSL]u%$葇$E6$<|EC,a$MU El$= lUĉ\$$D$xM MGAF z P$R }E% fEmm$a$u -l\$D$Eĉ$JxUGBH z P$R }E% fEmm$Va$u kMĉ\$ $D$wV$$a$&u kMĉ\$ $D$wEf8UGBF z P$R }E% fEmm$`$ u kMĉ\$ $D$;wUB'`G$G z P$R }E% fEmm$4`$D$eGG& z P$R }E% fEmm$_$D$eGG( z P$R }E% fEmm$_$D$NeGG* z P$R }E% fEmm$M_$D$e$dP i\$D$Eĉ$uŰJ1R1P,$ ď RQ,$$^$P XiMĉ\$ $D$uuEP@ЃD MQt   Űr utP$$t^$,u hMĉ\$ $D$u]<$!$Uȉ$!$}M̉ $vEăL[^_]à [UB$=$PBD$ 9D$D$$=$AD$ D$D${E t&Ũr [M ]Uȍ]MBEB EA EBEBfE\ L$$gi$Bg\$4$D$s$!Bmgt$D$Eĉ$st&P$G z $$R }E% fEmm$\$BfMĉ\$ $D$s@ZG z P$R }E% fEmm$\$ u fUĉ\$$D$rMGAX z P$R }E% fEmm$[$ B,f\$D$Eĉ$Ir t& qvUB}P$5BEf fEBm]m֋u$AH$=$BD$ 9D$D$U Eȉ$S$C<$C$3EUE$EUuu] ^ tf> v,$B4$]uE]&$ICt$$$$q맋t$e$UuȋCt$B$2Ct$+$Ct$$Ct$$CQ\t&]u]ÍU(U]M u}!f: v5$`CI1]u}]f: w$CH1ݍt&$,J1ɋR f=X빋r FXx9щ]X|:9})ы Be}ZR )1f9JDBH8R Z@ &';H  9rs)r U BfFf9<F f9rԋFEtE)U)ϋVE)EEBuFe ZFHJ;Bt$ \$L$$q p &UWVSÃL$ỦM7RE$R$EiRE؋EЉ$PEE'E܉D$EЉ$P$6R}Ef fEEm]m@D$EЉ$PE$@P~81&D$E$lPt $^Kt9҃EE9EbL[^_]É$RQËEȉ\$ D$E؉D$EԉD$Ẻ$ay}pt&}ruE؉\$ $CD$EԉD$냋E؉\$ $CD$EԉD$`'U(]ډuu}t~~z $L9$fpE ˋDDA9~~D$T$ D$<$_{]u}]øJD$ D$BD$$L t&'UWVSÁ$ t+$O(t$It$J[^_]É$$P,$O0($N8~144T$($(N$O}Ef fE4m۝Hm@D$($M<$MD1@&@D$<$ML@@D$<$Mt${H1ۋ@D$<$UMT@D$<$4MP\$ 0T$,D$ $XI 5~L$hM$JD$LJ$EMP1ۉ$UL\$TƉ$L$M}Ef fEm۝XmX$BHrÄHp'@@9DW4498[^_]Ív4$MqLxK$ML uP$cKhT$OKhEdd„ 11p1l`pT$P$7Kt$)F4$L}Ef fEm۝tmtUӋEu.%Hpv]C;t]D$D$E$}lfEG;`f}HrÄbE=D$$DdL$LK0]C;t]@pdp9h9l„t~9`j{ED$ $&JEfR|$E$|ED$=ll@xT$T$3It$%D$J}Ef fExm۝`ml`HpoHr\$ 0D$,$CT$m ~ $Cg1ۍ})D$T$$;KDf|]C9P\$P$=H$I}Ef fEm۝|m|D$$$fD]~fD$T$$*Kf|]fHr__u HpjD=PD$$D_>$LK-D$$ E$XPX$JT$bX$CT$$~ $?bED$ ƉD$ẺD$ $D0}U|$4$XE=eXXD$E$tDD$G2tut9E|$Et$Kh|$E$ED$6ED$$$fE|X$KD$HrÃHptE=>D$$4EkHp1HrE$cK4\$ 0D$,$CT$ D$$HDk1|$$E$F}Ef fEm۝|m|L$$D$FFxl}Ef fEm۝`mKXT$E$DD$lWEUD$$ED$$XE-$cK1ɉL$4$2D$E}Ef fEm۝|m|T$4$C$`E]}Ef fEm۝tm;tJD$ D$BD$$Lv'UWVSLEЉỦM܉MEE'E܀8dU1U&$K}'GEۃ3EU؉؉tҋM̅)EۍUT$EEED$ED$ ED$EEE$UMEU)ƸD$ D$t$D$$rE@Eԡ\$$PF~#1ېt&C$D$9uG$1bEۃt&'EE܃EyEԃL[^_]É\$$(F'UWV <SӁL \$$ 1D$$,D$$UX D$ $N\$|$ t$$dE L$D$$>1҉艅1 AY)A+E11҉`CЉ։5uu@9Xȋf<tыBRHoЋD$D$  $D$|$S 5 HU$=b1U$1$GC@EċGFUX$6;ufuJB\$ L$T$$Q&U$6fG E܉$$*U܉G$$GE܉$$GU uu}} ]EEEu؋u]}]ÁwD$4$"WX; X$HHr HBtzHtt$$F 1ۋH\$$4$/ $$MɉLK|$ t$T$$rE]$4$D $>$PEELP|$ t$D$\$$Hy4$o $$DL|$ t$T$T$1D1l=~+$?bEcD$t$$GpP<$RJ<$$L$$ltl$$TtT $$zH<$dX$+~\$$GiL L|$ t$D$ $%MP|$ t$L$,LL$$qeU=oHXsku T$ $+ EEH D$D$$n`5 D1tuԋL<$ E$1-P|$d$ d|$$UdT$ $I\$d$<t$ L$T$$D'EԉD$$LEԅt$$}E؅t$v$f8\E$P@$$'U$p.p $@D$1D$5]:D$$!$F4$}|$)ÍCD$p$~p$tH\$p<$Q1 H\ ~t$$Ht$<$1L \؋H $b\`$t$<$41 \؋`<$Dh1ۉ@hd_}ȉ|$$ aC$Uȉ$]xZML$$7ZNjll fD ҅$|$d\$ D$<$hFEE~3&D$ED$D$%EC9FًEh|$ t$D$\$$Mȉ $^_]$$X` L$<$cp$*$d$D҉u@*`<$\t\$0~ PL$IT$L$ltl<$$LtL$s$cPtP$S$CTtT $3$#H<$ X$?%0L$$HL$@$N$LT$P$*׹ $GKWH|$ $!$KD$4$MXD$4$MXL|$$Ht&t$$FyH$]UP$$xH1D$\$$ <JCPuX$ :dL D$<$T$@L$h|< D$G $B$YL軿 $ ,[ۉ|yۉ$F$1҉\$T$l$|<,<{l1$$w|$`GD$l$18TDP$,$L$$ltl $$TtT<$$Dt.Eԅt$$E؅t$$`$H$jX $!UpT$ $Z$Lz 11G‹9Zs^D$D$CL$ $w9Zr]2؋J)ltl6fD ҅g1D$t$$H/1J 9L D$<$a||YRftutD,tTft@f9r7, f9r1lAȍBfu܋|XG9||Z$mLv`y 뉝KDG_)ʋ)G+41҈1GȍAfw|lȅt&l fD ҅D$ D$ D$$9@;h_f<+GыWH1҉T$L$$Hz10^f:l$l$\1l&J~BL$ T$D$$L'UWVSL u} 4$ $k$LT$|$ t$$L$ D$讅x-$$$zÁL [^_]á~$?bt$$PIֳ\$4$@u$1zND$ $$Q1҉x$-$ D$|$$t f8 eL$T$ $gt f8D$1D$$6t f8$G1Բ$$:$$$ $L [^_]É|$$/$K[1M@ $jƋ1ۉ$x$ZD$ t$$ L$$($I1I D$$t$ $;\$$iX L$$b <D$T$ D$ $i D$E$D$C111vp:;zv#vGq9zJE)Љ։5t@D$ED$<$ٺ 5D$D$ D$D$$8 91fu$0s1ۉ\$$ $I臯L$4$1<l1ۉ $$t$$I0Pt&'U5ÐU1ɉE Ef9tɃ]Ít&UWVSE} tH0t+X1f9;u))f9<tAf9u1[^_]1Ƀ[^_]ùZNRLL$ T$D$$.e'UWVSE} tS0t7Xf9{t61)Ѝf9xtAf9uރ1[^_][^_]ÿgNAL|$ t$\$$.UVSuFtZf>N1ۍ&)ЋDt$$NCf9w̉ $$Ft$$}4$}E[^]g[^]ËN뷍vUWVSLE z]ME@UBtt=t $MM $B]$EG$E\Auf~ EUċM ]Bu fAT$$uȋUF$D$ F"D$B$D$?$EXC] uQHE@F)fC QF)fC u D$4$EM D$ $]C$$uĉEF2fH1ېt&U$sM܋ủFC9}ᐋU BD$-$M EA]DD$1D$$u D$4$NEE f81E]S@f MEuȉD$$$ E PӉ$U JfC ˉ$M fCAË$u UfCFË$fCEԅ7M E;E4U űJ\f9^]]E܋UtEЋ)։UfT@fDEԅEfT@fD 1Tt\M Af9MAB@fB1ۍ'U$#M܋uFC9}&\$$M`E H$t&U B fDB fD U&]$L\$&]܉$]$MuЉ4$J$:Ẻ$7$'Uȉ$$$Mĉ $$]؉$$Eԅtuԉ4$$U B@fBB@~/1ɻ uN9~ ] fKA9u4$$|L1[^_]ËFV F )Q)fA 4$A4$øu D$C$ỦD$ C"D$B4$D$:$E$$M詧$M蘧$M臧.N LD$ |$t$$.ct&'U(uuE }}]EFUM=Ff9sa)ЋVЋU@NMMfPUf8@@ff9~sf~]u}]ÍFf^$)Ӊ\$$$F_$NDFf9F륐t&|$$N@rMNaLt$ \$L$$.t&UWVSE $ u E UBtt=t $M螥M f9 ]$V;$E@$E0:uf~ Ew UM ]BfAu L$$]uUF$D$ F"D$B$D$7$E,<] uQHE@F)fC QF)кu fC T$4$E M D$ $]C$]$uEF2 1ۋU$MuFC9}܋U BD$ $rM EA]DD$1D$$u D$4$+EEE]S@fuą} MċU uZ $މ$UFuĉƋEuD$$rM$L$$|$4E ]PӋU$M UfC A]Ë$vM UfCA]Ë$ZM QfC]ӋU$>fCE'U D$MBD 4$D$E$LD$͟] MCS C )Q)fA $tM號%u4$$E$$EtU$$M A@fAA@~ 1ɻuN9~ ] fKA9u4$Y$IU 0 D$ |$D$B$WM ] Esэ)@NE#CQ1‹B1ۉt)EuEf9BtMfA"Nuu MFQ"Ё}DEr]fC2FDEM $$>]$E$(u4$E$EE f8}uEEEEU M܋]̋B)؉EHEx#CD$x<$D$9]tbEMP"ٍB99|1҉L$4$T$Mfy2tUC<$D$T$o9]uM UEA‹Bt E)E؋]f;C"bU D$M܋BD4$D$]f{2ED$E<$D$NjMU ]BˋM܋U؋D$ЉD$1D$U E܋JȋP@$T$D$MM E܋Y؋X]؋@UUM̉$M$=] EEES@@;EED$14$D$fUи4$D$T$GE<$\$D$D$B4$D$~}Euf~2mD$E<$D$]u UMԉ|$ $T$ L$uE$t$ D$t$MU$L$ L$T$ u U]F$C@fB$:M T$ |$؀  $D$D]$8݀ t$ uL$4$D$E$<6T$ |$4$D$U$^$N$N$>M $;$+]$($Č1[^_]ËuU fF2BED$E<$D$x]fC" fHt$Mi1ۋU$5MuFC9}4$&34$øu D$CC$UD$ C"D$B4$D$+$EE$5!$Mܘx$M˘$N躘$=NLD$ D$|$$.薿&'US$-$ff@f@f@f@ f@ @$ $U 1҉CL$T$$s1D$1$D$[]ÐU]Ðt&UWVS E8~^1F9tPCU $T$6uC U$T$ űCU$T$ uEpUB [^_]Í&UWVSڃfttft$Q[^_]x~=@f9w2f9XspH1t&f9wf9XsQF9u萍&[^_]ÍvH~Pf;rtV1f;Br{@9t&u@)bRxNL$ T$D$$QP14UWVSEU؋E9BE؋U@‹UfuUrtaFtZf>tA1v'FËCt$%$Gf9>CwˋF$$F F4$$ѺE@EU؋E9BAU؋B$$蟺EEEU9}E܉$E,[^_]pUR҉UJf:Et&'EuPf>V1vDt$ $V1DGf9>w͉$$չEUF@f9EwUB$$覹EE@$$聹UBBftftD$NVdUZۍCgk$3$#MUZ?Ct$ $C뼃,[^_]Ít&USÃt#@t$$ĸCfY[]ÍUt ]볍v]Í&'USÃt#@t$t$dCf[[]ÍU$$@Í&U(uƉ]}Ut8t4U$7fuDF]Du}]É!SD$ D$xND$$gQa$$wF~1t&'F?GUË$f9xt&'U]ÉutRD$xNT$ D$$Q葳'U(҉u}׉]tTuP$f$ffFtQftg$Q#؋u]}]Ít&KSD$ D$xND$$uQu1FF\F명u]FF$j$FF~EF]X$ EfF;E뒍@$$f~EFtt\E$Uf$UfB$UEfBF;E3CFEu]SUxNt$ \$L$$QƱ&'U(҉]ۉu։}t6u2$fuECEE]u}]þRuxNt$ \$L$$gQ?$$Tf;EECttUE1$UGuB$pUEEfB;EXECEuGSD$xNT$ D$$Q虰UWVSÃLUU$eUfEċ$ffC$$[E؉CU$UEȍE:U؃EEfuLBfB fBB ẼL[^_]øSxND$ vD$|$$Q貯$_$ǽUf:BEU؋EЋuċRЋUЉE܋EPED$U$,UEqUE̋EfE$޽$FUf}BE&'UԋE]P؉D$U$谿E܋U}ԋHˉ$CfE܉PӋU$)fCE܉pCD$3$蛼CE܋HʹBH~E1&'B6UË$fFE܋HBH9|ύL6EM@f9EEELEЋU@f9EVE.}ED$U$蔾E؋U&E̋ẼL[^_]C뛋E@뭉D$$N蓅E&UWVSÃ{ED؉D$U$=M$UfEEqf}ff}91ɉXEۋЉD$U$ֲM$y}fE$hfEEEftpftjftdft^=~D$$Oyt&XE;XEXxE9C$RUz2p]l$舯\$$藯$Op1f}-11fHEF9 EEpȍ\$U$蛱EfvffuM$fHuU$M$KD$U$7fff5lp‹Uk~$HRxGEF9NjllE&1lp‹UF~$1RGGx떋lp‹UFf$=RG xUlp‹U%$(RGw$E[^](V( US\$ L$T$$mT輛t&UWVSEtOU tHx,t6p$1ۍtD$E $tƉG$G EtE1`UAf9Mt+EHfv_,9}>G(ɋE$$T$$Sp17D$T$$ TpU$赦$襛$LTqp<$1!$$_f,G(Ei]@W(ډU$$)UD$ EL$D$G($舘G(UE@f9G,E$EEG(UɐUWVSLEUu}EEUU 4$Eȸ UĉD$cE$f2$Ëۉ$ۉ]EOE}EE9E$pË$dNj$XE؋$KE܋$>E$.f;]Euf;}uf}t Ef9EuUf9UvE9E}MEԋUЉD$$+U D$ E$D$D$E UEEU9UEu1L[^_]$hYn$=0|$\$$YD$ 蛙UUP&U1(]]uu }}D$1D$T$D$ \$t$<$t]u}]Ðt&D$ D$D$L$ \$t$<$uD$D$T$D$ \$t$<$at$=$YD$ 3D$D$臘1҉D$L$T$D$ \$t$<$D$1D$1D$D$ \$t$<$'UWVSu E]E$ɢ$1Etm}EE1%v9|FT$fFX$fFZ$fF\$fF^$fF`'Uu WVS1ۃ }D$<$葪<$Eu D$$(葛$Ƌ$$fF$fF$fF$fF $fF $fF$fF$fF$fF$sfF $VfD^Cu$AfF $fF")EmEfF$ [^_]ÉU݀ WVS1ۃ }L$<$Q݀ T$<$E轨$(Q$蹙Ƌ$]$fF$fF$fF$fF $yfF $kfF$]fF$OfF$AfF$3fF $fD^Cu$fF t $Yc$2fF")EmEfF$ [^_]ÐUWVS}$$#$苘ED$D$E$讠]øD$G$D$萠øD$G$D$uøD$G$D$Zt$G $D$DL$G $D$)T$G$D$øD$G$D$øD$G$D$؟øD$G$D$轟øD$G$D$袟41ۍ'D$D_C4$D$uƃu޸D$G 4$D$P\$W"T$$:E[^_] UWVS}$$S$軖ED$D$E$ޞ]øD$G$D$øD$G$D$襞t$G$D$菞L$G $D$tT$G $D$YøD$G$D$>øD$G$D$#øD$G$D$øD$G$D$øD$G$D$ҝ41ۍ'D$D_C4$D$襝ƃu޹L$G 4$D$腝T$W"T$$jE[^_] UWVS ]$ 舕$ƸD$4$D$<D$C<$D$ǸD$C<$D$ǸD$C<$D$ŜǸD$C <$D$誜L$C <$D$菜T$C<$D$tǸD$C<$D$YǸD$C<$D$>ǸD$C<$D$#ǸD$C<$D$ǸD$C<$D$ǸD$C<$D$қL$C<$D$跛T$ST$$蛛 [^_]ÐUWVS u$6$(ǸD$<$D$OD$F$D$4øD$F$D$øD$F $D$øD$F$D$L$F$D$ʚ1ҍ t&D2 Bu1D2D BuT$YF$$D$腚D$F&$D$iøD$F($D$NøD$F*$D$3øD$F,$D$øD$F.$D$øD$F0$D$L$F2$D$ǙT$V4T$$諙 [^_]$Y%\UW1VSLUE$EċE$tE1&<t9~9~Ǎ&'@=u9~$(ZZEȉ$mL[^_]ËE$臟1ɉL$$^]ЉE̋EEbU̅xr\$Ẻ$W YF\$ D$* D$* D$F$r* D$F\$ * \$$]I1G&'U8]ÉuΉ}}UE E E E Et7~3t/E t&t9uex[t5]u}]ÿa([|$ t$\$$T[E \$D$ ED$G$"뫉 $蠀¸wET$t$$aE?qv'U8҉]ӉuΉ}fEt7t3Et,:uNa([t$ \$L$$WZ~a([D$ D$|$$CZ~$@$V$辌\$lj$؂<$蘄tK}t(<$诌$蟁EUf؋]u}]ÍED$F$‰<$iw5toE ]E<$L|$$D$t<$'X9s@B9{~~EL$$\\D$RZD$T$닸aD$ D$([D$$/YzC D$$kfEU8]É}ωuUEUu]u}]ËtE$D$d$b}$RD$$$kUftSU1t5M $^uvEt$蹇$|\$衇$|GŋU1u뒸aD$([T$ D$$zT yE1\$$[D$ Q$[P`&UWVS< MEE$aU$E D$D$~E}F1$E$S1ɉL$\$ $n{1D$T$$YD$D$$6D$D$$D$|$$t$\$$܍1҉L$T$ $輍D$D$$虍D$1D$$y脷1\$$0]L$D$N$]N1D < t؋tZp_|$$uM؉؍U=~'ED$$^D$NED$ $蕠'D$ED$$iaD$([T$ D$$\u$.v@$1$虃\$$yE1t$$t1ɉt @ɉ/9&ω@~t7_D$<$$tt xxt~$ZM묋~,1}M؉FupF9ً2ZtZUM؉T$E $\$ t$$]D$K$$w$D$$]D$KM؉؍UF맋E܅t$oE؅t$cEt$UEEEED$$ i11D|F|tڋfD $D$ԜJ)DP$ $ T$D>붋$|f=D$$D$hEN$Bٽf f٭۝٭ P$$蝯$,u \$4$D$/ljD$$T$g1҅=$Xy D=$v{$訠Na([D$ OD$|$$ZcaD$ JD$([D$$cL$$y\$$莄FaD$ D$([D$$Zdc$l`P<$zh$H`D$B;$蔟:U]Ðt&US]x;|U \$L$$JT ;[] UtU D$$\T |;111Ðt&UEt@ùf.bL$ T$D$$/b&UEt@ø(fD$ &D$bD$$a&UEt@ø?fD$ D$bD$$a&US]t($1 U T$D$C$[]ûSfb\$ L$T$$KavUWVS)ƒlI؋<=< K9,CR~$hg1<_<;,D,H9),$f,L$u{9,S>l eӉ <7T$$ D$ =< 0$1,z 5e 0$:봋_=<0) <$1ɉ R $0C0_W1__  $딋1<y ^1Ҁ0\$$P $1ۋ0$A  $gU/HŠBٽVz=Vf fT٭T۝L٭VL94 4.~21ɍŠAJ9u)ߋ4=٭T۝L٭VL $iBJ4{01ZZZ Zi=x,0 ٽVVf fT٭TߝR٭VRC]٭TߝR٭VRC\STSLC [TC$[L=y)\$0$P $0$A   u5v0ACAC 0{A AztpACã $gq=<dD$$g4M$gA0CGG ٞuzؿQ0 <3<!11(d=!uHŠ٭T۝L٭VL`1@~ 9@9@ٽVHŠVf fT٭T۝D٭VD`e1~ ;D;D@9}~Yd1H1((HGh$0((H9u0 ` 0d $o$$#ɉB1ҋ1B< ~JG‹L$$D$_AGF9u$J#$:$4#$$ $#$Q$'k"$#3v$S!$#v$Fk!$K&L$<$3É$i#$H($8(9$$(ۉt$%|$$É$#$'s$'=`$'ۉt$z%T$ $bt"$"D$"akt $t& %@9};0<)ȋ~!1ېt&C9u担9~;Ë&C^F9݋mP  tP  {$D$T$A,$oCtE݄XܤD$\$ |$B,$m؅u݅1D$\$ D$B,$]mx< L$$D$<$T$$$t$O"t$w$gt$W$Gt $7$'<$!$l[^_]$m$$N$$8$vtC1؋vt1W$@Ƹk$!$Ƹk{t<$$t$$x$$]xP  mP UQQ  =[Q  %P tP Q$D$|$B,$k1݅D$\$ |$A,$i$*kD=$$t&,l1[^_]ËAD$D$$Q  HQ  goQ O}Q 7eQ  ]݅z&1|$?T$A,$i1ɉt$ \$L$|$LUWVS\E$q EMt}u%$k1\[^_]$T$@D@H@L@P@@@@$2BhAA $2GGGG G$G($$QG,Wh$$1G4G8fG<G0G>$42u8 G@EE>;UL&Er)jk }<$L$Vt8$n$x$h$@kE+v$8$( $;MvM}L$<$t8$y$Su$t&' $$ ;}$$} EMt E $Z1<$L$< $l$k =$$Fk$E$|$$$=rj$BU|$$3Q$a8ut,}4t$7$' $g$U$D$t$U4t$$ Q  uXME]$yC\$$6VE$[$K Q  uHE$.݅ٞ 1P  t(Q  hE$m݅zL$T$A $c1ҋT$|$݅\$ B $ZauD$\$$dlE@]$Pku$]"*t&1ҋETltZt$y@$$PMD\$$_딉$akH$ue%1ɋUL3ptZt$@$0$}D\$$딉$  $8}$sk1BQ  k.kdP  kE$jD$D$B $`݄\$K\$ L$G $^uqv[E~D>SD>F9]GEEUE $<$$<$r8E$D$|$B $_1D$|$݅\$ A $]D$\$$|$|$B $!]E䋍D$ $\JfuE䋽D$<$KP1$t$D$\$ B $Z$D$D$$\$L $ ݅X$Z0$:\$D$T$F݅`$(0$:\$D$T$FhD$ $.݅@ x$pQ$2:\$D$T $LF!1Q t$\$B $A $t j$I $ D$|$$ @ $i$YF@ $Z谼1D$P D$B,$Aݝ|1ɺP L$T$B,$@ݝ1D$P D$A,$@݅z]U1D$eQ D$C,$@݅zP D$1ۉt$B,$yAP ݅\$\$ L$B,$/?u1ɺP L$T$B $?ݝ(ݕ݅( O@@1P |$t$B,$?ݝ D$dP D$B $m?]D$dP D$A $G?ݝ0Eݝ8T^ E D$ @0D$D )ЉD$FJ$Eݝ1 T$$-L$4$\$[$M$1 6\$D$$B<$9"Dt$=$-1҉TCu͉$$$+D$x$G1ݕXݝ`o|4$j|fP<@t$ Cst$ GGt$i $]BB0t$C A0CP\$C $,C,t \$$,4$U $P D$F $?/P D$F $+/jkD$F $.8_|$t$B $8@A,Ee< L$$.8T$D$C,$8Ot$<$"p$$$vËG$iËG$\WODR J YZËË|É$$B\$D$4$lj)D$D$F$"4<$<)D$D$B$"lj)D$D$A$u"1W$D$jkD$\$ B $-)D$D$ $k< W$1L$)D$\$ B $g-\$D$ $1ҍ< S$T$D$\$ G $-|D$؉D$$! $S$D$I< D$\$ G $,G,t O$ۅ1D$I< D$\$ B $,ËAx@H$$SCRD$JT$G $5$D$$D$ $<$["$$ 4~*xL$ \$$hv t$}<$H<$Q |$ƋB $W*ݝ8f@11t&<0t9~9~Ǎ&'@=u9p$z莧@$P'$$$:$t #\$D$ $/$t#$ U #\$<$D$/x\$t$<$ <$&4$&$| 1[^_]$zz赦U$1҉T$$觩p΋pD͘dpD>\$D$ u1C$FD$D$@$d9}ۅpݝPW$ݝX@$7@$a%݅P$s$!\$D$H$-݅X$A$!\$D$H$-d݅8|$$؉D$1@$~8$@!\$D$H $Z-1ۉƅO$u 蕤D$jkD$F $*/A $$$I 1\$t$$x)Q&$ZϣQ 1ۉ\$L$B $:( 1ۋt$[$KCuڋ $<$,C1P D$|$C,$ &$$&u \$D$4$1*P 1ۉ\$L$B,$%ݝ $y SO$4D$@$ݕPݝXj\$$xx$u \$$Tx\$$TxԠt1D$P D$C,$$ݝjzwL$ T$D$$t&'UWVS,EVE$ËE$|$$E,Eܸu܅IE܉$t xb$Ru ku L$<$1҉T$\$$wmFP4${bE\$$2$$4$JED$E$kD$E$7EE$<$ƸD$ D$ED$~%D$4$X3$Et.<$!E܉$V1,[^_]$xEt$$w뼐t&1ۉ\$$$Py虝$y荝$y聝$zu$zD$ y3v4$<$[E܉$2zD$ PD$wD$$$@zӝU]Ðt&UE]-=4 Uuu}} ]Uw0C9C]u}]Áv C9srCɍC9v` (҉ЍSCK{$; 謜T$; 蛜$; 荜뒐UQQЍQQA~[[]Ðt&$z$1[[]ÍUSÃ)ʃ~.QQЍQQAZ[]Ív$zę1҉Z[]ÍUSÃ)J~0AAA~Y[]Í$zd1Y[]ÍUuƉ])J~!CCK]u] $z]1u]ÉU9s@~ɉ$zј1ɉÍt&'U9s @ɉ$z蜘1ɉÍU$D$N$;Ít&U$D$.$;Ít&U$D$$;Ít&U$D$$f;Ít&U$D$$;Ít&U$D$$<Ít&U)WVS9 EU@$n$UuËt$$D$9; ]}? uE9Euu|uG=uO$$zUu2[^_]É$ {Uu2[^_]ËE$D$EZ뱋E$|D$뙉]tvU$2SUVSÃ5ҍr ~!R;t;B 1t&;@ t&A9u$=\$|\$$0[^]ËB$:[^] UH}} 9=uu]ЋH PɉUк~@P$:;s sVC ҉UtBC֋֋E9~HM,Sȡ$=6t$ t$:|t$1$,$=\$L$$P{D$ EEzN]u}]á$=|$||$$̻$|ˍ$}${ڔ]E܉EE܅U܋EЉT$$eUT$ËEЉ$Q\$$5N8;MELU~EUgEUPEUo97t&*EUiEURE3U;EU$Z7E{U#EU EUE6UhEUQEXU:EqU#EU 6&EUEUEUkElUT6EKUS}EUJEԉ$3E$JE$J€U?w-icD$L|D$$=$Ҷ$c|8$z1U8}=u։]EF ;EMUw UB9]u-M}DU]u}]Í&U$%$}uL$|$t$ É$9t $|,uMD냍t&9‰UsEF]$C\$$T$ FF$\$$2$^ 9]EFv5}1ɋF)߉'}A:9uEF UWVS ΉEދF9F M|+XF^$s\$$$?F EȋX PEӉ;$UC$CE$UC $_NjE$RƍG$e$CF$O$UCT$ |$D$C$EL$t$D$ C$C8C0E@ D$C$&UCCD$D$D$C$iKC[^_]Í&'UWVS=e1U$T$7u E ;CF$9u׸D$!D$U$$EA |$U$CE==vU|$=\$T$$Dz9] E@U裸ҍ4Eˉ$@$u$UT$$ЋU @ @@P<$=$=$|D$ D$D$ t&<$=*=ft&0t&t&t$=t$|t$$茱=<$/E$$E[^_]ÍX9$ɿT$$׿$菿9Ӊ~#ҍD B@@$92==<$2M‰<$yM‰}uE[^_]É<$b<$$Ut<$T$$d D$ D$茲 =$ D$ ED$D$e =$ D$ BD$D$> =L$$0 D$ $D$@˨ D$$=T$$$=$hD$ %D$D$ѱ$=$D$ %D$D$誱$=L$$D$ 0D$胱$= T$$D$ D$\$萰&USÃ$$觭D$D$E\$ $t $1[]Ð}u1}$[]Ít&'UWV1S<$E܉U؉M<NjEE F <$9sUD$\$)‰$Nuʃtt$)ǍG$X$U܉$˭Ë <$躭<$)ËE܉\$D$U܉$蚭Ë <$艭)LEܺT$D$$=$U܉$Y$ƺ$.NjE܉<$D$E=@<t"D$<$ƭD<<$D$=Eܻ`4$D$QD$QD$ ˨ \$]D$4$0U tEL$4$T$UԉD$E؉T$ D$$K$質$;T$4$D$֪<$V$F4$v<[^_]ø&D$$=|$$蜪E UD$EԉT$U؉D$ 6D$$=T$$j0D$$=|$$K<$˸$軭x&'UWVSt_t[1ۉ'\$4$$|]\$<$$eEuzCuÃ[^_]Í1[^_]ÍUWVSu E^@<$1D$$ EHH+F8-u= @,b<w $D'H_8-t҃D<$ND$tD$$=$讨<$($t$8HDHDt$\$B$$袶1ɉtA T$$O DBD$PD$$=$*;H D<H1[^_]HiH1@<TH?H@<'$|$$"tE$ø D$$s$ȴ 7$$D$D$$=$試]$D$$|$ |$_DBL$D$$=$C$谦ٕPٝv'$j=t;$ |$$詶뷍&<$x@=w⍃0v$Y @ w$$==@<t$ٕPٝ$$1R1S,$؍PٽZZٝP ؅Pf fX٭X\$٭ZR1Q1,$؍٭X$٭Zf vXD$hD$$|$ e  <t' D$$-n$$<$<$  zt$$HB11ۉ<$1ɉt$ \$L$$>@E$E|$$bE\$$0E\$$t\$NjE$=@<@#W$ ٽZZf fX ٭X۝T٭Zۅ@T٭X۝@٭Z@11҉<$D$ D$$$+24 $P|$4$$\+4$2r t$1<$t $++ƻ \$<$1ɉL$+Lt$ D$<$Y$*T`=t 4${ D$<$$*!t $; D$<$$B*LtL$L L$<$$)<$1҉T$$$)$r D$<$N$)tpt4${ D$<$#$)4$R$C4$1qL 똋L_4$<$L1D$4$$bD$4$ݝ8$CD$4$ݝ0$$D$4$ݝ($4$ݝ w$Y݅0ٽZZf fX٭X۝T٭Z݅8T٭X۝T٭Z݅ ٭X\$٭ZT݅(٭X$٭Z$V$ Pٝ$ٝP<$$< v<$uUt1D$1D$E$D$D$$=$:V$ ^$ov<$;$: Pv$E\$$ \$ƋE$-tTW1$ $VٽZ5(Zf fX,$ ٭X۝T٭ZTۅ@1 RQٽZ5(Zf fX,$ ٭X۝@٭ZwU1Ut]ÍUUt E ]Ít&'U0]ÍU>]ÍU>]ÍU]ÍU']ÍUEtE]W]ÐUWVSUt;] t4|E~'ȍXu t MuZ1[^_]CZ[^_]ÍvUWVUM v]wW w[}EL MEP9҉ENEGE E EE ƒ(^_]Éu^_]ú)뜍&U E D$1D$E$RɅÐ&U1WVS,u] lKf@Ј(((D$ KfщЍ((D$KfэҍBк*(D$D$Cx)ʍR)׍D$CD$ D$D$l$*l,[^_]øD$4$#l&U]W&UWVS]} PH%@EtA}]G8t0]Dt"D$E$G81҉Tv'% E%E%EE Etd}UtP]D$E$XDD$U$?1TUtD$$E1ɉ%Et<}yt(UDD$E$輛1҉TE"%E0@EtvteWf1 FD$U$69wԉD$E$1g}e߽UE![^_]Ðg1ۉD$E$轚D$U$訚1Ɂg EaG|D$U$jgG|GD$E$gG@EfGGLD$U$gGL2D$E$D$U$ԙ11tc1t&FD$E$膙9ΉT$1U$]gEeUU![^_]ÃtV~/1ې& \$ CD$|$E$9ۋ11ۉD$U$ҘgO01ۅ~#@\$ CD$|$U$C9_0ދG8D$E$|G8G0~/1ې&\$ CD$|$U$9ۋ11ۉD$E$Q}t&'US]E MUttt$u![]ÍvE ][] []ÍU1҉M}} ]]u9r/ω $L$]u}]þDt$$u1ސUS]t } v 1҉L$T$$([]É$R$ƘˉUSD$ ]D$E $D$U|t"$D$艖11|E \$$E[] U1D$E$Í&Uuu}} ]t8t4t.\$4$1D$$D$]u}]ÉU1(Ut>D$$D$Et ET$$fEÐUS]x t=%=t"ED$E D$l$/l[]Ívt̃[]ÐU11ɃD$L$$UlÍ&U]]uu t!]u]øhD$$KԐUEU ttEJ]!Ðt&]1ÍUUE t t@ ]]1ÍUME tt]Í&]1ÍUUE tt]]1Í&UME t t@]]1ÍUUE t t@]]1Ðt&UME t t@]]1Ðt&UUE t t@]]1Ðt&UME t t@]]1Ðt&UUE t t@]]1Ðt&UME t#txyxxt&t&']1Ë@p]Í&UUE t#txyxxt&t&']1Ë@t]Í&UMU t#tzyzxt&t&'1]ËBp;Btt1&'UUE t3t/xy)Hpt"@t1R1P,$RQ,$]Í&]ÍUME t#t@ txlt&t&']1Ë@d]Í&UUE t#t@ txlt&t&']1Ë@h]Í&UME tt@ txlt&u@d]]1Ðt&UUE tt@ txlt&u@h]]1Ðt&UME t t@]]1Ðt&UUE t t] ]1ÍUME Ut t@ tҍt&tZ ]É]1ÍU E$U t$M|$]u} BEt Eقtقtقtقtق}$t E$قu(t E(ق],tE,ق$t$|$]É1덶U E$U t$M|$]u}Bɐtttt } t M u$t M$](t M(M,tU,$t$|$]Ð1썶UME Ut t@tҍt&t@(]É]1ÍUME Ut!t@tҍt&t]]1Ít&'UME Ut t@ tҍt&t@,]Ð]1ÍU$t$EU M]utPtLB tFɍt&t>t:t6E$t$]É$1t$]ÍvUEU Mttt]]1Ít&UME Ut t@@tҍt&t@|@]É]1ÍU$t$EU M]ut@tU$胗MBD$@ $D$҃,[^_]< $M\ƃE tD$E D$U$螌EUD$ML$E$x5 $聀pD$D $@D$ BD$\D$EHLD$ $}F$贆t&g‹H@D$\$7EthD$ED$U$譋M $uE$EthD$UT$M $dE$評tЃp}tt뷉ЃT]4+ uE$$mt&UWVSEtjE$EEEE(,E~?t&t+] 1&1FD$D$E$e9uEE9Euƃ[^_]Í&'UWVS }U ]tJuDt8Ut11 FD$1D$E$9uu [^_]Ät?ut1'GD$T$E$9}u݃ [^_]Ë]t1v'1FL$D$E$e9uu [^_]Ð&U]]uu t=@u!$Y}u u]]]t&pD$$?yԋ]u]ÍvUWVS,}yu nU<dUxމD$EUT$M<$EUT$$l|U$E>D$E\$$fuUt t&޿H<L޿R<E\$$'?޿M<u UE޿W<U D$ET$$ĕUU UEUh,[^_]Ë] )$|$ 3D$HEƀ|$t$$t4wGD$t$$T$U$vx0ExEU D$ET$$ַ޿W<u?EU D$ET$$覵UE T$UD$$޿M<\<uoEU D$ET$$al޿M<WUa~ІD$$`wha<uUE T$UD$$af<uEU D$ET$$育k<uUE T$UD$$Cz<uEU D$ET$$_<t3<EU D$ET$$萷UE T$UD$$™ExEL$$vD$$uІD$$u<t/<uUEU D$ET$$蝯XUE T$UD$$:U\$$fu<uUE T$UD$$Gp<uEU D$ET$$踥<uUE T$UD$$蹢<uEU D$ET$$Ze<uUE T$UD$$˖6<uEU D$ET$$ <uUE T$UD$$ݒEU D$ET$$v'UWVS,}u ]t$<$A~?gM @t&pt$<$t1D$ @D$t$<$Ih<$D$Nt$<$f,[^_]Àv5t,T$t$<$? <$ (<$Ƿ@$&'D$t$<$;ED$t$<$E<$D$!<$t&<$ v<$vpL$<$ rQt&<$&v<$Hv<$踶jv<$QF<$D$m@FnE]t$<$h<$D$|mEE9F/v'UWVS}M .1B :Du뺜XT$\$4$Xk}6 D$1D$$olt$ D$$k@B@B |$$l 8 D$T$$%t`QD$$2p11 |$t$$Ĭ[^_]Ãtt뫸D$$o1D$$rn$k$lÉD$$oXv'UxEuu }}]E}E}1҅]t-\D$Pt$ D$$ jE\$$mPD$ L$D$$iE\$$m}us}uG&E|$t$$]]u}]À}t1҅]U뀐t&E11۹L$$\n뚋E11۹̈L$$6n}l몍v'U1D$ 1D$EL$$zÐ&UStED$U$T$jm@B@BEE${iM L$ ED$UT$M $hED$ UT$M L$E$jE%1BM8 t MuߋUM 8  $D$iU   \$L$$!:t&'tD$U$lM 1D$1D$ $E$ hEt[]ËEtEM:U\D$]PD$$T$ f\$M $jP\$ ]T$L$$f\$E$fjU1XD$$kz8D$E$xk&T$M $_kEEt[]<1t<0#Ex8 EUU$D$TfM1ED$U $T$cfEA:„c'U1(D$1D$1D$ED$ ED$E D$E$xÐUS]UtOE ҉tHt*1L$$hT$$h1[]ø 0 뱍'U]]uU ut;t$$D$ D$b9t]uE "]]i]u]ÉUSEt[]E -E[]ZiUEt ]Ív'UEt @]Ív'UUE Et3%ȡ Hv$ ٚٚ ؍u΀ulj'UEt]ÍvUEt]ÍvUEt]ÍvUEt ]Ív'UE]Í&UE@]Í&UUtE ]ÐUS]M tKA<fvtt A&yfAv'y&afAAZA^fAb tA(t y@tI`ta@t$A<t<uHtyu AAt y<$A@taAtA%ftA<t'8Arp8Ar_ Aa<AvÉA []ЃA []<ADAM&A뫈A8AsAZIQAfA+fvtu"AAfAARAܐUMWU VSA <w0<9t6<tnEP @ MA y[^_]Í&tҍG4GЃZ) 9tK$uN1tG4GЃZ) 9iK$uN1MG4O:щƒX) A9'K$uN1䍶'UWVS,]}C<US )ƉuG)ƉuG)‰UtC W)ЉDF~e11ɍU @9t<@9ut;C <wL<u)[ۍt&tU 1A$UB9uv',[^_]C W)ЉEd<<uՋM΅ɉMtȋ] 1ffS1EȉGL}EȉC9}u뉋u{øÅdU Ev' ؈BE;}u,[^_]ËEƅE#] 1GU1L}UȈC9}u'U |$}$t$ t$t$|$]Í&w t!M 1ۉʍCA9uG G W ‰G렍UWVSEM UPtct[[^_]Àx u@t1pÍt&'CGKS C9}u[[^_]Íx U@t1pÉCGKCCCCCCCCS C9}u[[^_]Ë}@.1Kt&F9uu]@1X'AFAAA9uu&USU] B <t0<t[]Ðt&z tKɋBt1B9PPu[]Àz tBɋBtƍ1 &B9PPu[]ÅɋBtD1҉B9u댅ɋBt1 B9PuhUWVSMEƋuЋUGEE9EMsSK C C f9uf9u듋EMESMEƋuЋUGAGAGEE9EqQY A A f9uf9uEtt&UVSU Ett.~&tPt?[^]Ht&ut& U11ABB؃9[^]þھΉUWVSEMEQ E]C<5ukuKEtDu 1 FCM}PV9]u֍[^_]ÀuEt]C<h<"<ùHEtu 1ۍ&MCF}PFVVMPFFVVMPFV9]uA1E*u 1ېt&MCF}PFVVMPFFVVMPFV9]u[^_]Àtquu 1ۉ'FCM}PV9]uaUVU 1ɐA]B9Mu8}-U 1ɐ&A]9MuEU 1ɍ}ABBBB9MuM] 1}ƒ    C9uwq]fE EE'Uډރ щ0 у Љ E    € MMU   $0E ً] MEEEUAEM]9]7}W EpU 1ɍt&']ABBBB9Mu0UWVS Ex0t [^_]Ít&@ <<<}ȉ}G G wUtmE ] TÍH)7J9ˋ}@D8@D8B@8Bt%I;E}}J<t [^_]ÐE@ @ UBBB  [^_]ÅF} FU ǍFЃZ) 9KuO1v]tO} E L1ۉ}vU})CB@D8B@D8AB@8A9uŋE@ @ U@@ P[} FU ljZ) 9XKuO1;] F} Nу]ǻ A9CU)ڨuO1UWVS|E8@uzEEt MIMԋ]C <]tBu^ \u<FF F NjUB|[^_]É<uMtMY @U<BB B NjMA|[^_]<t?<]C C {]1nGWeMԍEtu GU EGЃr)U9utNUƒuM1ʍ&uԅE ] T{ÍH)J9tJIff9uJ9uUZ [EUԋMEUڋA=] u LC1ۍT!AC9߈BAt#E:BuE:uA̋MY GKUԃUTu GU ƍGЃZ) U9]KЃuN1ۋUԃ)ЅEu GOƋE E A9CE)؃҃҈uN1׋EUMu@RIEۋFU܈M'U 1ۍDt't&VC9߈BABt+rAUۍH:PuU:PuU:uV뾋u^ uNVvEЈMMEUމEAU] 1DT<BF9BCBCBCBCBtJCMX:HuM:HuM:HuM:HuM:HuM:uB늋EX UE]UuM }]8@<t&t<<]u}]Ðt&tu~ uͅtAˉEvSK ЋU FE;}u͋uF FF <F NjUBmeu~ XP1ɍ&'AB9u*u~ zˉESK ЋU FE;}u+G=&UWVSUu JEB <<Et uxE]tj1&^GFN F FV ȍЁF^M9}u[^_]Àt u}t݉1ɉ'BAB9Mu[^_]Í&UWVSEـP1p?t1D$E$>@Ut&M݅p\$VF$5X$[< X}R Ef fEm]mEވuE`ļ[^_]ËEUE~ E)EMt }#}EEU)UEEMeUUMفPɉ41x?|ED$U$>M}1~+EFT$$>;uu`?ܵx1U\$D$$:E1ddRP,$}MEE}Eݕhf fEm}mEEU L&EM!C9Lf PvE}UE\$ER  h$:܍h}Ef fEm}mE9؉kE}~9dv*EdEM!C9fPuM`}Eر]ȉD$ $!=UE1EXM1EˉML$$<Xv'U?GMEȋ\$1RV,$5`$8 `}R Ef fEm]mEfuEEU X9U7MفPٞ]ED$U$;ME,1E\EU`Ét$$;\1t&M?G`E 1\$RV,$5`$7 `}R Ef fEm]mEfuEEU \9U7ļ[^_]9M9F?E؈ݝpl]g1ETEUEÉt$$:T1M?GU݅x 1\$RV,$5`$6 `}R Ef fEm]mEfuEEU T9U 뱁@Q&: ` UUEEtM}]E$hE f fEm]m]Em]mrÍv'UM]Eu] }uɋ}tNtjCBCfBٙ% ؍&']u}]ÍvE t]u}]U]]uE ut2tV5tX+N]u]Ãu΃t\vu׋% u% ]u]øD$$c% j% 7% 4'UVSpuH@tAdtfvt 1D$H@D$\$n%@}`@t yfv tKt:D$D$ D$H@D$\$v@ Y@t %fTtgtH4$@D$\D$u\uHfe<gv\`p[^]Ë\ƒ߈f뱐etfvJD$,D$(D$$D$ D$D$D$D$D$ D$H@D$\$t&H@D$\$gYFD$4$H@D$\$衱KH@D$\$ H4$@D$\D$Ɔ%`=@m%`= D$4$ D$H@D$\$>Y\H@D$\$P@vLD$ HD$H@D$\$3`$\$4$DD$ D$H@D$\$aH@D$\$XH@D$\$Z^H@D$\$g3D$H@D$\$]H@D$\$VH@D$\$qH@D$\$SvD$D$ pD$H@D$\$ԋ]ƉD$@T$$D$ 2D$ \$4$D$D$4$>}'UWVSEU M]u}hd`\XT@\9`X`t$h<$ ~1ҋhB9`u苝`K9\10h񋇨nQoX8Bf;zs(ohnL010F9u0u K9\hT;\h1`dI:9\5T IJ9\~dfDFhG9\uT$1h$ h\`hpu dpT`hft1L$$) hHT$|$$ t$$ EL$T$$g `QdEu}EGEGUEEЋEȋMЉHP@]9]P)É]ԋ}E }؋E9ENjH)NjU1MU܉MXt&@)9lj}U9}ʋMȋMUE 9}hMH F t9u|@)링[^_]ÉEă} TE}  EE]9`uhu }[^_]Hu)PE)ƉuL$$1hL`1ҋhLB9`u`t$h<$t$<$~#1ҋhB9`u߾ t$h$Eu1ۉ\@=u`EEE`GLL9u]ME:^D> T$U$T$D?[^_]ÉЃތ[A]AތA7[^_]É'UVS M] tP u"1t D$ $҃ [^]Ív;#uٸ< t@ut&뾀;#u91ɍut&Dʈ1< t IuB v,t&'$=\$\$$ [^]ÍD D$ $=t$gt$$aJt&Uxuu]M t"].\$4$]u]ÉL$$]u]Í&'UWVS<}] t uBt \$<$Ѐ;#tȞD$$=\$$ <[^_]À;#t]E0E롐1ҍuԍt&'Dш2< t BuA w+D$ D$$=Dt$$tD$$=T$ \$$Qv'< tBut9BE~Gut&'D1A9uEЉDD$<$uEUxuu]M t"]N\$4$R]u]ÉL$$8]u]ÐUS] SCS[]Ð&US] SCS[]Ð&UU]ffRÍ&USE $nx[]øD$E$l[]Ít&U1WVS]$T50(¡)J1҉,$4܄)H1<<ȍA&&(,$<4@8t't6<wfvt ɉ't6<ts<u  t&'@tHfvbb<SY<B't(9 $BAt@;4/4@;v8D$D$^4$@D$D4@41҉T$@D$ D$D$@[^_]ÍBRt&&(,k <0t&@$D$~t$$" 4HL$$ȍA@7<fvMVUUUEE)svfvɃ H@~&'U(uu]x tH%=t?]D$\$4$莏$];lu]tD$ED$4$O]1u]ÍvUWVS,EU }w $DD$E$<,[^_]B Z9v&AB9uB Rp)UJM1ۉCAB9uM7UΉuUtE}EEBUU؋EE؉UUEME:BU܉))1)Ɖ1)É1)99֋E~ 9ӋE~UEԋE9EuB Rp)UM1ۍvCAB9uE>ƋEЅ1t&'GFAC9}urM1ۍt&CAB9ufE}Eu됍v'UWVSEH\xC|x|\‹tƉExP xEet& ||FtEȉE̋EىlHЉEp)ppljpv'U̍M|$ $T$t~D]1t&'EF$|$D$l9tu܋Ep)ȉEEЋxM9 vp)}뇋E9E3MMExU9P MxvxCĜ[^_]‹U‰E؋xS 볁FEEEEEs|F|EȉEEHNjtMM1EEF9tUظ??)"Ј9]u΋]O͋UMUFEEEEE@|F苽|EȉEEHNjtM~NM1EEF9tt-UԸ)"Ј9]uFO]9tuӋE9EtMMEȋxU9wUMUFЃEEEEEЃ9]NMEEEy|F|EȉEEHNjUt~NM1EEF9tt-Uܸ)"Ј9]uFO]9tuӋE9EMMExU9wFЃEEEEE@Ѓ^Ӄ]]EEEӃUMUut&UWVSlEUu =Eg<<r<[H$҉Ut^yEE}t2EmE9Et4EEt߉\$|$4$?}uϐEEE9Eu͐l[^_]g<$ˋHMu@E l[^_]$HMrEEE]̅t]@1EEȀM˃}tU}F9uXEȅEt%U??)ك"ˆ9]uEG}]u'EȀ륋$HMEEEU]@1EE&EÃ}tU}F9uEEt%UЈ)ك"ˆ9]uEG}]u'E륋$HVEEE$HMEEEU]@1EEEÃ}tM}G9}EEt%U)ك"ˆ9]uEF}]uEEEEwEEENvUSM ],A<9w [wvE ][]OQ,A<9w[vQ,A<9wπ[vQ,A<9w[v[]UWVSE uM1EUEȉE)Љ 1|tt& D$t$蹨E{t {t|l 4$)@D$,|$|$T$|4$D$ ; )ЋD$ $T$ );|{ }tf}~}FxD$ DD$]4D$$\$4$g|gE|t$̞1E4$D$|UE:EĜ[^_]Ë }4$)׍GD$|fME|)ʋT$؉$L$_UT$ED$|$C|8|4$T$*E4$D$L$4$]¿2D$ t|$$D$|\$4$(UEEEĜ[^_]ËD$4$t$s1||D:Ћ]))E}Ow/|ĒM|$T$ȉ$7}6ʋE4$D$D$4$ux4]D$ L$T$$u4x\$]D$ |$$IĒE4$@D$|t^ED$UT$|$d^}4$ |$u|tCED$UT$|$'U4$T$D$4$뀋U4$T$hD$4$뛍U]]uu}} t*t$|$$~uu} }]]]N]u}]Í'UWVS}M 9Ήs=)U D$<$D$TEÍ9r؉…ui<$j1҅t(x u)u)\$<$[^_]u׾t$<$[^_]ÉT$<$D$|&'UWVS,U@@;,@EU EExUVt&D$E܉$lt UMD$ $]]uUhE1ۿM<\$]$UL$\$$|M\$ $o]h$>LET$$D$fuuhD$$Uhd щh9 v]T$$D$)h0L$$ E1҉Uhu tMGD$ $]܉$;E,[^_]11@4|$@D$ D$D$\ȍAM8(04Љ1)H,<uwM<H]ȋ$܄)؉H1E<<IȍA@C[]Ut t*M~|$ $Y] Whtʍ&UWVS,]E UxEU}M-U$T$>x %fu xEtzx}GFƃEx1҉t$$ЃWt.$D$11E ],[^_]hx D$ t$E$D$/1맋M$L$=x^t$$M<ME艃t&U$T$M䉃D$L$$Hxv'D$ t$U$T$d0}$|$ =^D$$uD$$t&'UWVS,}Jt E<$@D$LEt$<$D$g1ɉL$<$U>tC;u9{)ED$\$Et$<$D$ 1D$ED$<$EF؉FEF D$ t$E <$D$ =t$<$}U<$T$nuC,[^_]úT$<$t$<$E,[^_]þt$<$<$D$,[^_]û\$<$M,[^_]øD$<$4D$<$U<$T$Pv'UWVS}E ]Et CD$<$E2\$U<$T$n1D$<$E];t&C;u9øD$<$E^F$F D$ t$U<$T$?;ËE<$D$t$<$u3[^_]øD$<$%E}E [^_]kE }[^_]d<$D$U}U [^_]/E @}[^_]i'U(]]uu}} t G u3t<L$$ t$$1]u}]Ít&uĺuT$t$$1D$$uE4$EEEEEEEEE|$$fEED$*pГD$$.\|$)&'UWVSLE }]Eԋuԅt E@ 0CD$<$E \$E؉<$D$1҉T$<$}EÉ]]؀;tt&'C;uC 9EC$EC$EC EC }E<D$<$1E؉E }L[^_]2D$<$ ] }L[^_])D$<$8{D$<$EE _}L[^_]}}t }V}t& C Eƀ{ t F>u]<$D$#Eۺ~)FE9u܉tsF9u>uBC9u׋ED$ E\$D$ED$ED$ED$ E؉D$Eԉ<$D$:E؉<$D$yEJL$}g t&{D$<$뵄Ct&D$<$jE؉<$D$E v'U8]]uu}} tNu?t G  tKD$$t$$]u}]úT$ԹL$$ u uD$t$$r1D$$uED$E$4$D$ |$$D$#tٔD$R&'U8]]uu}} tNu?t  tKPD$$t$$]u}]ø#D$Ը D$$ u uD$t$$r1D$$uED$E$4$D$ |$$D$"t;D$R&'U(}}]]utou:E t E @@t9t`˕t$t&D$&<$\$<$]u}]ølމD$<$t9uwt31ېEL$D$<$8E$f]C9u1҉T$<$ruD$E <$D$(dD$BD$2U(]]uu}} t~ujt G <t҃9tMFL$$t$$]u}]øD$Ԑt&D$$뎍uT$t$$ 1҉T$$\u<uf4$ffffD$|$$#SD$)1|$4$4fE$"fE$fUzOnff9w>p@ffE@fTffDf'D$$U8uu]]}} tnuLt Gu>|$4$\$4$]u}]ú{T$<t|<t8D$bL$4$2t9ww-ݖL$4$1҉T$4$3vD$TB]D$\$4$fv$KfE$9fE$'f3]D$\$4$Ffv$f1D$4$}t1fvD$v|$4$D$ D$#ĖD$4$\$D$4$fvxvUWVS,UukFD$E$t$D$NjU$T1D$E$l7?t&'A9uQ9TAY1ɉ<))ֈE =EFD$E$EU҉U5pEFffFfCfFfCfFfCfF$,UEf 9U}t$fFC$fFC$fFC$fF뜸 D$E$,t$U$M,[^_]øD$$TT|$U$,[^_]É|$E$%D$U$,[^_]ÿT|$U$,[^_]ÍE}\$ D$E D$E$*|$U$ED$E$ ,[^_]É|$U$:D$E$0,[^_]þdt$E$ UWVS,}4E t U B }E<$@D$U<$T$ƉD$l1D$<$cU>t C;uSH9e{)ED$\$Et$1t$<$D$ EE)9MSK S 91t$\$D$ UT$E <$D$K-U<$T$\ T$<$E<$D$,[^_]ËU໸<$T$\$<$b,[^_]ùhL$<$nD$똸D$<$(t$<$,[^_]øD$<$#t$<$Ɨ<$D$,[^_]ÉE<$D$nT$<$&U(]]uu}} t^uJtG u[t&t^9T$$Mt$$q]u}]Ít&D$Аt&ۗD$$_뛹$L$뭉D$ED$$1D$$ uu'GtC-ȯ=v1D$$D$iD$$=$G->v=w~-|=wl-=wZ -}=wH-Hq=w6-x=w$-6=w-=v@D$$t$|$$m$w D$$0UD$$KUuu]]}} t[uLtG% tH|$4$$\$4$H]u}]øD$ԸD$4$?랻\$]\$4$$L$\$4$E$}8Ew!=8wEU=vVt&'D$4$oD$4$AD$4$HИD$ D$\$4$$HL$\$4$E$(EċE̋U=v'D$4$D$4$D$\$4$z$L$\$4$EZ$EȋEЋU=v'1D$4$_D$4$~1D$\$4$$\\$4$EԸD$$<ËE=E$hSEEEE]E]E]$]G E->v= E-|= E-=E-}=E-Hq=E-x=E-6=x=1D$4$,E\$@E\$8E\$0E\$(ʉ|$\$ ɉ4$\$\$\$Eԉ\$$|$4$D$ EȉD$EЉD$EĉD$ẺD$ED$ ED$k]ɺ@]ٝxٝhT$4$NbD$$=E\$ E\$مx\$مh\$$^~D$$=E\$ E\$E\$E\$$,J\$4$1ɉL$4$t&'U(]]uu}} EEEEtnuZtGukt9t_D$$>t$$b]u}]Ðt&|$ϐt&D$$O닺T$묉wD$ED$$1D$$utYEEEED$|$$/H˙L$$iEE맍U8]]uu}} tnuZ2tGt4&'tNrT$$t$$]u}]Ð-D$Ӑt&D$$닸uD$t$$E1D$$u4$tCG t=8P=v0D$$)D$$=t$$WLV$5$hٓ\$|$$t$|$$ED$$]L$xD$$U]]uutD$$tD$$Cu u]]]_ UWVS,}]p"]+R9VUUU)…҉~F1t&FD$ED$<$GECECEC9u1ۉ\$<$yD$E <$T$ D$'uqM tjU Btaf9vE f9XvDD$<$߿U fZ*D$'<$踿\$<$,[^_]ÐtBD$кКT$<$D$미D$<$iD$<$đT$<$2fv-UWVSLu?} t>L$4$@ ]T$\$4$1D$4$\$4$g4$E؍ED$U}]UMEEEE؉$E܉(E<w$Ɔ<vO$4E\$|$4$D$E܉T$ L$D$ E؉D$E D$"L[^_]$묻,\$4$ƆfƆZƆN&'UXuu}}]m] t E @ @GD$4$dD$|$4$1D$4$:<;1}{D$ED$<$虵E]؀8;tt&'@8ux9}sOD$4$衼\$4$E#vjD$4$|$4$v]u}]1D$ED$<$E8Eٞ\$E\$ 4$D$E D$\$4$褸낉QD$4$/DD$4$ɻTT$4$賻>L$ؿ|$ظlD$4$wUEt]Í'UEt t]Ã]ÉUEtwƀ]Í'UEtw ]ÐUUM tA]Ð&UEtt]]Ð&UUtHfE }ft:tuvƂ]Ƃ܍včt&US ]t E$D$E D$l []ÍUEt ]Ív'UEt ]Ív'UEt ]Í'USU] zu Jt1Ґt&B@9u[]Ðt&Bf=t(f=uJt߉1ҍvP9w[]ËJt1ҍv9w[]ÐUVSEx t[^]p tM 1ۍCAQ9u[^]Ð&UVSU] B <w<Rt!<t<tt&[^]þ&9s1)ٍvB9u[^]ÍUW}VS] G7<tZ<t8u" E@tg[^_]Ðt&<uE@tvE@&tԍ&' u j}vvBٻQt&CABABABA BA BA 9u̍vG 0GG ?& }y8v SDDSB9u6G GG tى1ۍ&'ACAB9u뻅bى1ې&ACABABABABAB9u}yotى1ۍ&CB9uG wE}xat+ى1ۍACABAB9uvG Gtى1ې&ACB9u덃vɉڹvBDBDAB9u UMVS] Q¨tZA 1<tT<uLt}t&u>t:1ۍCAQQAQA9uލ&'[^]Àt[t&ut1ۍCAQ9uʅtƉ1ۉCAQQAQA9u뜅t1ۍt&CAQ9uw&UUtE EE]É'U1Ut]ÐUEU ttEBdEJBhEBl]Ít&UMEU Et$t ɋEݚJ@ݚ]]ÍvUEU ttEBpEJBtEBx]Ít&UEU tt EJB,]UMU Et"tx;}ED]ÍUMtU $]É'U1Ut E ]ÍUUtExE t]ÉUMU Et t!B]Ðt&UUtE E]ÉU]]uu t<$D$( t$$Ư ]u]Ít&UU]] uut>t:t9t1D$ @D$\$$ZtK]u] U(uu]}EE|E4$<؉ED$Et-U|$D$$4$D$1U]D$E$D$ЬE~E 1ɉ'BA9MuUEp|]u}]ËE v(} t ́֍UEU Mt t t]ËBt:x@P$5$h[(Kuu]E u]y]u]øD$4$^1KC(븉'USU] Et\tXȣٞwgS(}$h Ef fEmۛmKt[]Í؃[]zE U[]鲪ظѢD$$蝪xKC(ŧF[]ÐU$EM]U u]EE ɋu}}EE$EE(EE,E,$ E E E E E9 EEEEE܅E쉚 E艂E䉂EE܉S$$hٚ4$$ٚ<$$ٚEٚEٚEٚEٚEٚJ']u}]ÍvE ؟M]u}]t&E ፴&UEEE E(E0E8ME@U ]EH]j_TI>3Eٞ!Eȣ.!EEޞْْْْْْEٚEٚ}$h Ef fEmۚmmۚmmۚmmۚ mmۚmmۚmEUmۚmMmۚmJÍ&#}z{t&EzE&E ؟MÉE M¥,uz%E x UVSPu] ;3E\$4$D$oX?L$T$ \$4$D$\$4$pD$$:D$ `D$0uD$D$&zL$T$ D$\$4$33?D$@Q?@D$D@D$833?D$<@D$033?D$,`D$ ?D$$@D$z?D$1L$4V?T$(D$F?L$T$D$ \$4$/P[^]Ð&UWVS,EU M]EUM}uȋD$E$vEM}싑81U䋂D$M $ uEEl$t$D$ԞC D$U$GC S $D$T$蕞C G CGEU9UtbUE}싊Nj$zpt$M $p‰VL|$E$}EU9UuMEUI ,[^_]}t&Lt$M $ D$E$諞UE U,[^_]ס&UWVS,E} uU EZ0؋Z49~hJ8J8B4D$EM$;U B8ډNjuvUMT$ $ܝEuE(M D$ $EE9EE M X0I8Mtى$蕛V҉UEËFt 8EUMDD$ $V‰C|$$D$C8CǍW}Su8CUEM S EA09E?'1,[^_]ËFM$D$L$訛밉$辚EEMċEU MB4B0D$ $荝U B8tʁ@xuIEM$L$-UvU8E}}]] uuEEEEEE4$@ED$<$ۜEEt$D$E$蒚E<$D$諜ED$E4$D$c1D$ D$\$<$EKE쉳E舃]u}]E x}]u}]HE<$D$E UWVS,E]U MEE ]]UU$MM(uۋ}E܉U؉MM4$衘X\$E$藛Uv\$t$$N]UE䉻M܉]؉$=X\$E$3U\$]؉$\$U܍D$M $]U܅E$M]ԋ|$$D$艘EE9EtaM]ԋu$腗xE苐|$ӋU$pM0u]E H],[^_]uUJ,[^_]E MM,[^_]@E ԠEE E말&USE]D$ ED$E $D$)u[]E p][]+t&'UWVS u] }D$4$;w E;vL$4$ U~EHv)}t#}t}t>D$4$vEE};}1}'}v5v'}F}:}0} ~HL$4$U$tE(t+TsD$4$貛E;CECECE$CE(CE CE<N$CCtCCc~CvsC [^_]ÉE@*XD$4$}}D$4$t&}<vMljC [^_]Í#D$4$蟚~D$4$2G뮃}(@}}t&lD$4$*7t&CD$4$趘*D$4$蠘Ft&'U(uuE]] }}Ev2{tu]E u}]9D$4$x1D$ D$\$4$mD$4$\1҉pL$T$$ǔpD$E$D$kpKCftfC]u}]ÐUU]щ T Ð&U8hE }} ]uuEEEEEEEEȋL$ T$4$E̋ED$+t؋u]}]øD$4$XuEЉ4$ȉ4$u뵍'UD$ED$ ED$E D$E$ÐU]ÍU1WVSM ]E}ډЉځڍ4Eօu(vA1Ћ<1Muۃ}yA&'wO1%Ƌ1ڋ41411ȋO ԋ1؋41411ʋO%Ƌ1ڋ41411ȋOԋ1؋41411ʋO%Ƌ1ڋ41411ȋO ԋ1؋41411ʋ%Ƌ1ڋ4111ԋ41֋m 11ƃ}}vMt&m1Ƌ4ы1Ƌ11ރ}wMt.1ɍ&'T9A1Ћ1;Mu҉Љ%%Ѝ[^_]ÍvEօu%A1%<1Muۃ}B 7O1%Ƌ1ڋ41411ȋOԋ1؋41411ʋO %Ƌ1ڋ41411ȋOԋ1؋41411ʋO%Ƌ1ڋ41411ȋOԋ1؋41411ʋO %Ƌ1ڋ4111ԋ41֋m 11ƃ}}vMt&m1ڋ4ы1Ƌ1Ƌ1ƃ}w]t,&'B1% 1Mu[^_]Íy믍U1Ʌ҉u t&t3u]Í&'UWVSTDC!u[^_]ÍUWVS] 1T@҃uttzt@teuBt)tNtыUt EuE 1EE[^_]ËUE믐UEu]ËPtzuE B1]Ð&UEM u]ËPtMH!f1]Í&UEu]ËPtE EEEB|1]ÍvUщ$Xt$p HT Xt$$]Í'U]]uu]u]ËCtp*t/Et*It%[tgtqtuPtT$C($S$CPDtT$C($S$CP@tT$C($S$CP8tT$C($S$CD$C($S$1qC]D@u]Ív'UWVSӃ,@|NlV,EEЋF8NjFxEԋE؍9v )сM܋F4N@EEԉMMMDEE ;MrmNt9M؉Mv#MEM!A9]'MF8ًUE:uE:Du:uA:GuMύOMȋMG:AGEG:AuuOMȋMG:AucGEG:AuTOMȋMG:AuBGEG:Au3OMȋMG:A u!GEG:A uMM9Md}ȹE)})9M;M؉^p} DʋMEUԈMʉE9vЃ,[^_] UWVS@8_lUٍ:C:AAQ:CubAQ:CuVAQ:CuJAQ:Cu>AQ:Cu2AQ:Cu&AQ:C uAQ:C u9w&)ֹ)~EGpGt9wZ[^_]Z[^_]Z[^_]ÍU(uu ]]}tt FEu]u}]t$L$C($S ƸtúsT$U4$T$tD$F,D$C($S F8D$F,D$C($S F@D$FLD$C($S FDD$D$C($S N8ɉljFF@FD]F,S8 $D$T$蹄F,N@S@ $T$D$螄FLNDSD $T$D$胄NSF $T$D$jCKV)ЉFƒ~@ $ | 0 1A$=/vUuƉ]H@Y9vÅu]u]Ðt&V A\$$D$貃V)^^ ^)ZZBu‹BB]u]ÐUWVS,@,EEt&{FlN8VtE19}MUsUtZ})}'CC@DXMEUЋ|$$T$Nt;{M܋MȃFtv!^8VlNXFHT1ЋVT!ЉFH~t@FtNK1 E苗 fE苗 f뛋E fNu f&E- fU ]ÍUU]ÍUU])ЋÍv'UE E]YHUEM E]EUEu]ËPtB@@@@00BlBPBL1BB BB B(B,B0B8B<]Í'UESu[]ËPt} Z^htQN tlSN(9s+U F4L$)ʉT$$"?F(F,1F 뗋^4E |$)D$ $>~,փ> j1D$1D$$)'U |$T$$';F6V!vU]]u}u]u}]ÍvstC tۋ3> C 1S dClV8`Nw$`V t EFt0UظmD$EM؈UD$MF$詫F1pEh`hpBp`E؃pvF tU؉PFtFMmEmMUmEM؉D$EUD$MF$F1pEh`hpBp`E؃pvV tE؉BEB F1EpFF t@FhN@U9vMȋEȅF tQP҉0tDP@)ʋMȉ4E;4v4)ы0L$`ЉL$$;FtEȋ`D$T$F$譩FM)h`)N@F@F@FhEE̋`V ẺEtJtF@;B s U@F@ME׀}t M9hwFM)h`}F@FhEEЋ`V EЉEtJ$tF@;B(s U@F@E;;t M9hwFM)h`;yVfF t P,@01D$1D$$ FC0 h`hpBp`E؃pvE؉F%$Ch`hpBp`E؃pvU؋E ЋUeM؁EЉFC01pF .1D$1D$$G! FC0} 'd`lS hpKM؉SFw x;Stx+CMS)xKtN)CEFt0t,Vd VD$M܋C $)ȉD$FC0~N<1Ѓ@> JЉC,t Et } ldYh`hp`pE؃p vE؃pF`Em @FdEm~`F\~dFhFh;F\( Ur:{h1`hp`pE؃pvE pEEmfDVp 9V\(Vhw(w! AfDFpuFh0FlFLFTD$FTD$FlD$ D$FpD$$XCK h)`hp`pE؃pvF;E|CFtUppmh`hpBp`E؃pvE؋U؃FЃM<W&5pUh`hp`pE؃pvE؉F@F tU؉PFt0MmE؈MED$ED$F$sF1EpMm)pMN@ >@ƒFHVH҉ tr9psDh6`hpp`E؋p9 w UmH!F@ )pNXVPH\E؋\X!ȍHMP'9psjh`hpB`\pE؋E!ЋXHMP';pw'Ez ʉMM)pmE@H EFD'FHVH҉ tr9psDh`hpp`E؋p9 w UmH!FD )pxN,l)9FD l)lx)‹FD9-)Љ‹F09I N()‹F4)MF@9wЋl9|v||)l)F@d‹EAEJuF@|dk`FWFFu@t&hQ`hpBp`E؃pvE9FCP1V@EpF@h9v‹lU9vEċEąUċ`dT$L$$a0U)h`)ld)V@:FlFX0FlFLFpNlDFTFT T$D$L$ F`ˋ] >t&UV1S UE EtI$1UƍBEt0;L$4$D$64$UލBEuЃ [^]Í&UWVS,] EUEtu<EUBE1҅tA1UF|$E܋$!M\UBEuɋU܋M,[^_]É<U뉐UWVS,EuEE EEFv'UBEt$U%FEtԋFt͋FVF VVtFT$$GZF FVtFV$D$$ZF $FEt]E܉$xu P@t;uP:@uF8N $D$YFE|$$3F VtFV$D$YF NFF$XKF,[^_]Á>$,F@ $D$V D$3lj$5 Et8uf<$ @ $D$QD$3lj$Et8u.<$I $EX8O]E}=vUH}}]u<t]u}]Ð3vl,=L$D$$=$D$=T$|$$*$=$/ D$ D$D$ $G $1lD$ooD$xxD$ D$t<D$$<1D$ t$\$$1ɺlL$ T$$E1D$<<t&'#<1D$(D$$D$ D$ D$t$x\$L$T$D$$ <1D$oL$T$D$t$1\$ $<1D$oD$ xD$D$$t$$E1D$ D$ = $=D$$1҉D$ D$D$D$L$T$(D$t$ \$$1D$oD$ xD$(=D$$(=1D$oD$$x5P=h=E1ɺL$o1ۉT$$t?l=1D$oD$ &D$D$$l==1D$t$$&?1҉\$ L$T$$Ee==L9(=11ۉD$oD$ /D$t$$=o\$L$$/1҉T$ $E8D$1D$1FD$=OD$$LXT=1L$D$t$ \$$=1ҸFT$D$$O$E1D$ WD$1D$@4>1dxo1]L$T$8>t$\$ $8>1D$]D$$do$E1D$ nD$1D$`>s~1ۉL$T$5|>\$ $|>1D$$s$E1D$ }D$1D$GB >1D$ t$\$$>1ɉL$$1҉T$ $ED$1D$1?11ۉD$ D$D$$?Gt$$'L$ T$\$$ E1D$l?$&@$蕍EƸt !K1:ˈF1D$=TD$$ H?1D$FD$ t$\$$H?o1ɺFL$T$$D$ E1D$ D$1D$??o1D$L$t$ \$$?1ҸoT$D$$$ E1D$ D$1D$ 1D$=1ۉD$$ FTL$ T$5?D$\$$?N1D$FD$$#$ E1D$ D$1D$o5@d1ۉL$1\$$ 1D$ D$@D$$@1D$$t$$ E1D$ D$ 1FL$T$X@t$\$ $X@H1D$FD$$ $E1D$ D$1D$id1ɺL$ T$D$@$@1D$$$E1D$ D$1D$*H1!L$@t$ \$$@l1҉T$$!J$E1D$ GD$1D$KR$A1D$FD$ t$\$$$A1ɺFL$T$$R$E1D$ D$1D$Y,hA11ۉD$ jD$t$$hA\$$jfE1ɺtL$1ۉT$$LA1D$ zD$D$$A1D$$zt$\$$E1D$ O AA41PD$1ۉD$$?A1D$oD$ D$t$$AoL$\$$W1҉T$$E?D$ ?D$1D$B0B1oL$T$4Bt$\$ $4B1D$oD$$$E1D$ D$1D$ \B1ۉL$T$5xB\$ $xBm1D$$K$E1D$ D$1D$B1oL$T$Bt$\$ $B1D$oD$$$E1D$ D$1D$ B5B1ɺo D$1L$T$ CD$$CY1D$oD$$.t$$E1D$ D$|(Cq1҉D$ & D$8/T$5 DCD$$DC1D$D$$&t$ \$L$$E1D$C11D$:1ۉD$$_DC1D$ D$8D$$C1t$a$ 1ҹC\$ eL$T$$EU1jD$(HD$$MD$ RD$WD$\D$t$\$ L$T$$C1D$ D$D$$Ci1D$$GEF1ۉL$ T$D$5D\$$D1D$FD$$$E1D$ D$1D$831ۉL$T$5TD\$ $TD1D$$$E1D$D$ D$D$oD11ۉD$D$ D$hD$$D1D$t$$\$ L$T$$EDD51+DL$t$ \$$D1҉T$$+EE3 E1?D$HD$D$oL$D$t$ U\$1$ E*1҉D$D$ oD$?T$D$$Ht$\$$ E1D$PD$ . `E1xD$o1D$ wD$ZdED$$dE1D$oD$$T1ɉt$ \$L$$!EEE{E1D$ pD$D$$E1D$$pEE1ۉL$ T$D$5E\$$E1D$D$$$#E1D$ D$1D$oH1ۉT$L$ 50F\$D$$0F'1D$oD$$1ɉt$ \$L$$$E1D$D$D$71ҸXFpF 1tF1oD$oD$ D$xD$$tFt$\$$ ^1ɺL$T$ $%ED$1D$FF11ۉD$ (D$t$$F\$$(EJ@ .? F$uAT$$L$t$A$V 1D$D$@ D$ T1҉T$ \$1$FD$h@ $tt$$/\$$3E@ G1 @G$qtAT$$$V 1D$D$@ D$ ?D$D$t$ \$$@GD$@ $tAL$$1҉T$$EGZe1oGL$T$t$\$ $GK1D$oD$$e EG~oG11ۉD$ D$t$$G\$$1ɺL$ T$$*E1D$1D$ D$D$$* H1D$ t$\$$ Hc1ɉL$$A1҉T$$+E츇D$ D$1D$1D$ D$D$$+`[o1ۉL$ T$D$5PH\$$PH1D$oD$$$,E1D$ | D$1D$o1ۉL$ T$D$5H\$$HG1D$oD$$EH1$D$oD$ t$\$$H1ɺoL$T$$$.E1D$ D$1D$ BQI1D$oD$ t$\$$Ir1ɺoL$T$$QG$/E1D$ w D$1D$\I_m`I 1D$ t$\$$`I1ɉL$$mE<1zD$o1D$ D$ID$$I1D$oD$$r1ɉt$ \$L$$1E1D$ D$4ID$$I11D$$Ew,Jd1D$ t$1\$$,J1ɉL$$1҉T$ t$$3ED$D$D$D$D$ D$TJ$=$ D$ D$D$<D$ <D$D$$=$$=$$=t$<$ D$ D$<L$D$$=$e$=$$=T$$ D$ D$A<D$D$$=$$=$4$=$ D$ D$D$FD$D$$=$$=$$=L$$ D$ D$<D$$=T$$\$=$$=$ D$ D$D$8<D$:D$$=$$=$#$=$ D$ D$D$<ND$QD$$=$$=$$=L$\$$ D$ EkT$D$$=$S$=$v$=$ D$ D$D$/$=$D$ D$D$$=$^ &tD$ D$$=$uۡ$=$ D$$=L$\$$ D$ $=T$$D$ D$`$=$s<&tD$ D$$=$uۡ$=$ D$^$=8$ D$ D$D$<t$D$$=$$=$$=L$T$D$ $ {D$$=|$$Q$=$t$=$ D$ D$D$-<D$XD$$=$$=$$=$ D$ D$D$$=L$t$$|D$ $=$<7t5 D$$= T$$NCuܡ$=$ D$$=$ D$ D$D$<D$D$$=$$=$$=t$$ D$ D$<L$D$$=$$=$?3a33B33v$=$D$ D$D$1$=$D$ D$D$$=t$$D$ D$&{!K?KE?Ut&UWVS<} ut U hEE U < 4$$$ EFl.L$M $EEt/T$$!EԋE$g<u0#$A9rU9t)‰T$$vˆ4EuE$xoEEԅt!E؅sMt1D$ D$1D$4$Dt U;Dr|EG\$$k1҉T$ 4$E D$1D$UD|ƉD$E$tkU1D3$[^_]á$=$DD$ D$D$$=t$t$$$=\$L$$/ D$ $=$;{ E,UWVSLvth@ ?D$V D$U$D$ËT$$O($}4$ke[^_]ÿ=$-t$ÍE$|+EUL$$W;E‹UຜT$$ifpJ҉Et MA$Ґ}<$,E}ԉ<$EG_ExGHOEN MK}x}UDP uՅUԍ\;\tMt&D$Mԉ $}ԉ<$$]ԉƅUԍx\XE$+u$=|$$DD$ D$FUB\$D$$=$$=L$T$D$ $/ $=$X&ux Fx DB u%#uv.tGxӋDP u=u݉)C$YeEЉ\$t$$Mx{ GDB u.Gۈ]DFGEEDB ue1ۉ[^_]$-t/:u0:BU$=$DD$ D$D$\\$D$$=$]$=|$$/ D$ D$K$=$^Gx[ӋDP u=u)C$cẺ\$t$$UxGx2DB u=u#GxGx DB u<$t6 MYx(U؃t&NtJx DA uF$@cEȉÉ|$t$$}7u CCt<;uC:CuE̅t6ẺD$V D$UЉ$MЉ $[}̉<$P]ЋEȉD$U$T$ &t&'Mԉ $PEUB<$D$aMA$}}Eĉ$15 ML$$T$\"0$>\$ L$T$$Uuu]}4$.NjE $!D$at$É$E D$;$؋u]}]ÐUE]uu}$4$ËE $D$ at$É$E $D$(E$D$؋u]}]ÐUV1S UE Et@$QcUƍBEt'4$D$4$UލBEuك [^]UVSӃt*t`8tQtS8t&u=BC uր;u11>/t/t P@u1Z[^]t$|$U $,MAM̉EЉ4$5ẺD$T$$yt&CDu4FD$$A`ۉEtT0ٍt&BIuM؋ẺMĉM1ۋ ɉM&UT$T$$E$]EԍE$%=EMԋUEQU׍v'M$L$UЉ $F;~t$Eԉ$>EuhU2t$buEMċ ɉME؉$?U 9Ut MЉ $,Eԍe[^_]Ð$t )1느t&$=$ D$ D$D$at$EЉ\$D$ D$$=$,$=$O$U؋BtU1D$$)$:tqދMAM$[\$$]E؉‹M؉BẺMĉM M E$녹L$$UWVSLuEE؍e[^_]ËE/|$$E9Eu){<$ZU\$T$Ɖ$D>M t$\$ $pEԋE@E1C9eUԋtߋ }MT$L$$Uv'CDu4FD$$a\ۉEtT0ٍt&BIuM܋EMЉV$8WE؉t$$_;UŰt$6nEMЋ ɉMZUT$$T$$EeYE؍E$8EM؋UẼQtŰtE׍t&M$L$aUԉ u" $tu1+$=$ D$ D$D$EԹt$\$L$D$ $=$$=$냉$U܋BtU1D$$É$6ދMAM\\E܉$U 9UMԉ $U UN$WT$$!Z‰E܋B$RoD$$э&UWVS|$ <L$$E%}T$EE$@EUEEE{UEU܋Ẻ$X$WỦ$ED$DU\$$ƋẺD$EEEEEw$?tx:xtL}tE<.uCt9<.r$YU$T$D$1E&'$4$wẺ4$D$TM$= T$1$DD$ D$ỦD$$=T$$$=$/ D$ D$D$$=$$=$DD$ D$D$$=t$1|$$,D$ g$=L$\$$/ D$ E$=$XU$tEU܋$xEtE܋Eu U$LEL$$(T$EԍE$iEUEԉUԋ҉U~E1ۉE؋Uп|$$EE U$EE%#3EĉEEȋEO| DB uEuȉ'xӋDP uFu^~t | Gt | DB uUȀ:t t&Eĉ$8EлUD$$QU؋$EtE؋EUԉ$ne[^_]øD$$Uڅ v.D$B$TFz/uBtu&Ft|DB ut&'E~$uEuiEg1UD$ T$$$9]t$螼U$蓼E$舼U$}}tlUE$T$D$͋U܋ET$$KC,[^_]ËUD$$EEu$= t$\$$DD$ nUXEL$T$U܉D$ $=T$$3$=T$$/ D$ D$$=$/E$t$= |$t$$DD$ ӻE܋U\$D$$=T$ $褷$=L$T$D$ $/ 荻$=$蠷c$=$DD$ D$D$TEUD$E܉T$ D$(D$$=$$=$/ D$ D$D$$=$&UWVSE$ K5 taED$ $T$t+t%|$$tJue[^_]$ 训 \$$L$ÍE$EU I'Cu+zE$!D$Ë T$$$)e[^_]ÐUVS1ۄt1ҍXAAu[^]Ðt&UWVSD$4$藟tNL$D$$͍T$D$$词4$OT==E$:|=8=<<E$$DE$D$,Et=|$$+E$4E$)4$!][^_]뼐UVS$9r 5t&K9s+;/u؉D$$`0ע`0[^]1;/uэ&UWVSà 8tf&'Ct T$^JV 9t9:C:C>9&É$$$ 뉸` ` D$$=` u /u` ut/u4$3A$4$t x/H4$j"Ƌ$t$$"$4$B"$.ÉD$$$("$:ljD$v$4$覛$螛<$薛,=$!U ң(=LE $&@ @ $D$$|[^_]É4$A0z/JtHJ9/u$=` |$t$$i$` M1&! t€t;҃f/t$D$$V =҃f/o/f` z+8(0$褖1}$*tFI:u;J:Bu/K:Bu#L:Bu(=$@ p(=$$@ Y@$` $q4$$M&'U1D$E$9ÐUVSpu4$$T$4$du(ED$t$$虗tb'$ud4$øD$$uED$\$$FtL9u`1ۃp[^]ËE%=@tp[^]Ð u$M? uʼn4$1뺋E%=@tp[^]É$1T떐U}}u]<$(t&X)C$ \$|$Ɖ$F]u}]ÐUE@]'US]Ct$诗CX[]ÍUWVS] uۉu]UM111$E荶E;uF;ut.E1;tUD$UBC$νUGŋUt%1ۍv'UBC$E9uUB$іEU8P[^_]É1$%UB EGPӉ$!;}u܃[^_]Ít&UWVS E UƋE׋U3D$B$ UBt!1 A9u [^_]Ít&'US]@D$C$ U CT[]Í'UWVS9Ét$Ȓtƒ[^_]E}~1鐍t& $舆EbU]ˉu։}ljT$$C1҃vAu41ɉ1tMt M9qA]Ћu}]Ãuʼn¸u뤐t&U8E܋E]ӉM؉u$E܉}Kt]ȋu}]Í1RS,$58z }Ef fEȡ m}mE)x-<9w9tEM؉$EFu9w܍<1Րt&UWVSM EU1ۍ&U)Й1)9sމCutbF~E';UtEM$Eu5~} u)ƁE9]|1}tt1[^_]Í9s' O두U U)=뻋u FEaE됍U(E]1ۉu}ED$$fUME$U EtMtUZ E]u}]ËE$ӉUv\$$fsEMU $tʉ$}EEtEtU EPU_=tEMU $EEu,5t$$fUM$U EtzE$uU$ED$E$TU $T$EUD$$ExEMU $ELUWVS ]$EtEUC :u#C :BuC :Btat&'u׹ u 1[^_]ËE$tvt\$$t$uC :Bu [^_]ÐUWVSE`U4$<DD$\$1`EULEPU u1@@[^_]Ít݋P$gNjE -vۉtIx菍ӋPu,-t'+t"_t.t/t&/v'^Fu}<P1ۉDj&L$C;Pu㋵PPU $B7`81D$$E$Lt$$ϊPbw$E$4$$ ƍv'ET$_T$$: 1Ɉ__4$D$4$$먋E$~DL$\$4$UELUPE$GE$,E$!$1@}}!t! $耊GuD$hD>8v$趆E$蛆$n4$PH  4$@;@g@$'d8D$$艇Gt?&d8$ D$qd8D$F$JCuˡd8$ D$>$݅$υ1ۉHt#1D$ D$1D$$$H\11 L$ T$D$4$ËH/'ED$H\$$0M`Mbщi)ƒGT$ھ:)‰11҉L$t$D$H]$T$ D$諈\$$$=$|D$ D$D$t5 D$ D$$=$>Cuܡ$=$ D$D$ 2D$DD$$3úD$ E T$D$$=$σ#$h讃$蝃gKH t 1`8N$w <1<0 FuL$$ad8D$$=\$$d84$h@$蹂4$衂et& ȃ‰ȉT$i\$]D$ T$$v$=$DD$ D$D$Qt$ D$D$$=$!$=$/ D$ D$D$ $=$-T$ U D$$=T$$1@4$1+@o11҉L$D$HK\$]$T$ D$lH1҉\$]$D$1T$ D$=11ۉ d8$0 t9$ \$T$$蛫øFuD$$d8d8ٻ(kM E$菀t$$g$o}t"$]E$BE$Gt`8u_4$0|$$t $$$؃HYT$1҉L$]$T$ D$N$4$赃닐U8uu]}E >!t>~t,U:tF]u}]À~!uE#F~tmEq4$1҉ƋE]4$e9Ɖt4$~$|\$D$E$$~U$~[^_]ËE${t 8yU$ld뼋C$= |$pt$$DD$ ~E\$D$$=$yz$=L$T$D$ $/ b~$=$uz?&UWVS>t94$[É$9Ét$z@v[^_]á@ <$D$QD$É$`w$zt>u<$Cwt 8w<$褚e@t$=$ D$ D$D$zt5D$ \D$$=|$$v$=$v[^_]øVľ#t$ \$L$$vUS]$wtx/Pu J/uC<3/ttu [^]á$=L$T$$ D$ tD$$=\$ t$$`p$=$p[^]ÉU$]Ӊuq|/t'D$$P4$D$$]u]É$UVSӃt'<$mnE܉$<$e[^_]ËEU܉$D$U܋ME3롋EU܉$E댍U܉D$$]EĉUE܉t$$>U܋EKE܉$p<D$ D$D$$mt&UWVSEu1[^_]Ít&E8t=|8t6x81 t&F9t tU$T$ muߋsu$E$)U |8@|8D$x8$U|8$أx8e|8Cx8t($=\$|$$ D$ pEL$D$$=$jl$=$lt2  T$D$$=$,l[uݡ$=$ D$o$=$3lxUS]$.څt[]ËE $D$V D$hܐU.VSuD$4$Lnt 4$m9rH9s8/t&u1[^]ÃC[^]ÐUE@@]UMU 9QvBAùtFL$ T$D$$b2kv'UVSÃBKCD$$KS9w܃[^]Ðt&Uuu ]]}4$ llj‰t$$l{]u}]Ív'U$]t$u QC C$t$]É'U]]uu؉E t$D$CЉ$ms]u]Í&'US]t"$0mCC[]ø>FD$ \$L$$vi&U(}}]uJvIwuE$8|$ËE $D$l;UErBЉ]u}]wEK뱐UWVSE 9EEE11ډUP$} Ef fE1҅t؃~čv؅~Í&'؅t|m]mME)BwO΋EEEu }'t؋Et1u;U9t3[^_]É…~um]mM낋EH뼋u[^_]ËE UE$Wjuá,=D$D$$=$bg$=L$$D$ D$Kk$=T$$/ D$ D$$k$XjUS]$it[]á,=D$1D$$=$f$f$ jU 8uu]}tUt = 88t$$T$貲t1ۉ t;؋u]}]ÍET$$EU88끍ED$t$$h4$|$$8D$-u$=L$T$$ D$ iD$$=\$ t$$e$=$eE%=@c]cUxED$E$D$(g1҅uE1%=@ɉÐUWVS )pt vNu& [^_]ÍvUWVSHÉ c)Et1֍'G9}u [^_]Ë$ÐUStv'ЋuX[]ÐUS[iY[uniagl: fix %s --> %s.%sglyphstr && dstppagl: %s [%s] --> U+%06X U+%04Xtexglyphlist.txtpdfglyphlist.txtglyphname && suffixsmcpscswashswshsupssinfnumeratornumrdenominatordnomonumdisplaytextbigbiggBigghungarumlautmacronogonekcommaaccentampersandexclamexclamdownquestionquestiondownMapping to multiple Unicode characters not supported.Invalid char %c in Unicode glyph name %s.Invalid Unicode code value U+%04X.Invalid Unicode code value U+%06X.Invalid glyph name component in "%s".No Unicode mapping for glyph name "%s" found.../../../../texk/dvipdfmx/src/agl.cAGL entry ignored (no mapping): %sFailed to load AGL file "%s"...C . . . . B . F . . . /  / B / / / $/ (/  -/ ? T U@ ? ? T@ 2/ ?/ F/  @ @ M/ > Y/ c/ j/ u/ ~/ agl_sput_UTF16BEagl_chop_suffixCould not read BMP file header...File not starting with 'B' 'M'... Not a BMP file?Unknown bcPlanes value in BMP COREHEADER.Unknown biPlanes value in BMP INFOHEADER.Invalid BMP file: width=%ld, height=%ld, #palette=%dReading BMP raster data failed...No EOL/EOI marker. RLE decode failed...Not a BMP file???Unknown BMP header type.Unsupported palette size: %ldUnkown BMP bitCount: %ldReading file failed...IndexedDeviceRGBColorSpaceRLE decode failed...in cff_fdselect_lookup(): FDSelect not availablein cff_fdselect_lookup(): Invalid glyph indexin cff_fdselect_lookup(): Invalid FDSelect formatin cff_fdselect_lookup(): Invalid Font DICT indexin cff_pack_fdselect(): Buffur overflowin cff_pack_fdselect(): Invalid datain cff_pack_fdselect(): Buffer overflowPredefined CFF charsets not supported yetin cff_pack_charsets(): Buffer overflowPredefined CFF encoding not supported yetNo CFF supplementary encoding data read.in cff_pack_encoding(): Buffer overflowSentinel value mismatched with number of glyphs.in cff_read_fdarray(): Top DICT not foundcff_get_index(): invalid index dataFontName string length too large...%s: CFF version %u.%u not supported.%s: Invalid CFF fontset index number.Parsing CFF Top DICT data failed...Only Type 2 Charstrings supported...CFF Synthetic font not supported.Unknown FDSelect format.Charsets data not availableInvalid GID.Invalid GIDUnknown Charset formatEncoding data not availableUnknown Encoding format.Unknown Encoding formatNot enough space available...CFF font not opened.Top DICT not availableFDSelectRange not starting with 0.Top DICT data not foundinvalid offsize dataInvalid CFF Index offset dataFDArrayPrivatereading file failedSubrscharsetCharset data possibly brokenInvalid SIDCFFCFF Top DICT not exist...CharstringTypeSyntheticBaseCharStringsROSquotedblnumbersigndollarpercentquoterightparenleftparenrightasteriskpluscommahyphenperiodtwothreefourfivesixsevensemicolonlessgreaterNbracketleftbackslashbracketrightasciicircumunderscorequoteleftbraceleftbracerightasciitildesterlingfractionyenflorinsectioncurrencyquotesinglequotedblleftguillemotleftguilsinglleftguilsinglrightendashdaggerdaggerdblperiodcenteredparagraphbulletquotesinglbasequotedblbasequotedblrightguillemotrightellipsisperthousandAEordfeminineLslashOslashOEordmasculineaedotlessilslashoslashoegermandblsonesuperiorlogicalnotmutrademarkEthonehalfplusminusThornonequarterdividebrokenbardegreethornthreequarterstwosuperiorregisteredethmultiplythreesuperiorcopyrightAacuteAcircumflexAdieresisAgraveAringAtildeCcedillaEacuteEcircumflexEdieresisEgraveIacuteIcircumflexIdieresisIgraveNtildeOacuteOcircumflexOdieresisOgraveOtildeScaronUacuteUcircumflexUdieresisUgraveYacuteYdieresisZcaronaacuteacircumflexadieresisagravearingatildeccedillaeacuteecircumflexedieresisegraveiacuteicircumflexidieresisigraventildeoacuteocircumflexodieresisograveotildescaronuacuteucircumflexudieresisugraveyacuteydieresiszcaronexclamsmallHungarumlautsmalldollaroldstyledollarsuperiorampersandsmallAcutesmallparenleftsuperiorparenrightsuperiortwodotenleaderonedotenleaderzerooldstyleoneoldstyletwooldstylethreeoldstylefouroldstylefiveoldstylesixoldstylesevenoldstyleeightoldstylenineoldstylecommasuperiorthreequartersemdashperiodsuperiorquestionsmallbsuperiorcentsuperiorisuperiorlsuperiormsuperiorssuperiorffifflparenleftinferiorparenrightinferiorCircumflexsmallhyphensuperiorGravesmallAsmallBsmallCsmallDsmallFsmallGsmallHsmallIsmallJsmallKsmallLsmallMsmallNsmallOsmallPsmallQsmallRsmallSsmallTsmallUsmallVsmallWsmallXsmallYsmallZsmallcolonmonetaryonefittedrupiahTildesmallexclamdownsmallcentoldstyleLslashsmallScaronsmallZcaronsmallDieresissmallBrevesmallCaronsmallDotaccentsmallMacronsmallfiguredashhypheninferiorOgoneksmallRingsmallCedillasmallquestiondownsmalloneeighththreeeighthsfiveeighthsseveneighthsonethirdtwothirdszerosuperiorfoursuperiorfivesuperiorsixsuperiorsevensuperioreightsuperiorninesuperiorzeroinferioroneinferiortwoinferiorthreeinferiorfourinferiorfiveinferiorsixinferiorseveninferioreightinferiornineinferiorcentinferiordollarinferiorperiodinferiorcommainferiorAgravesmallAacutesmallAcircumflexsmallAtildesmallAdieresissmallAringsmallAEsmallCcedillasmallEgravesmallEacutesmallEcircumflexsmallEdieresissmallIgravesmallIacutesmallIcircumflexsmallIdieresissmallEthsmallNtildesmallOgravesmallOacutesmallOcircumflexsmallOtildesmallOdieresissmallOEsmallOslashsmallUgravesmallUacutesmallUcircumflexsmallUdieresissmallYacutesmallThornsmallYdieresissmall001.000001.001001.002001.003BlackBookSemibold@ZTc/ < < < = Y/  = = = *= 3= 8= >= E= > rYع L= P= V= [= `= d=  B> n= j= t=  y= u/  +57 t /> .LOW  0 = l )     > > !> .> <> J> oC sC Y> `> g> q> > > > > > > > > ~/ @ ? ? @ ?/ TT?  @ @ 2/ F/  U C > > > > > >  ? ? ? ? &? )? 4? @? K? N? X? \? d? n? t? ? ? ? ? ? ? ? h? ? ? ? ? ? ? ? @  @ @ @ !@ (@ 4@ >@ E@ L@ X@ b@ i@ p@ w@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ A A A A A +A 5A ?BP IP RP ]P dP mP  P  xP  P  P P P P k< jk< I< e< P P P P P P Q Q < Q (Q 4Q >Q HQ QQ  [Q  eQ oQ }Q Q < Q Q Q  < @Q Q Q Q Q A< ; Q cff_dict_setcff_dict_getCIDFont%s: Invalid ID %d%s: Already initialized.UCS%s: CIDSystemInfo undefined.%s: Invalid wmode value.%s: Object not flushed.fontdict && descriptorCIDSystemInfoRegistryOrderingSupplementSubtypeCIDFontType0CIDFontType2Unknown CIDFontType "%s"BaseFontFontDescriptor(CID[%s][CIDFontType0][CIDFontType2]%s: Unknown CIDFontType %d.AdobeIdentityRyumin-LightGothicBBB-MediumMHei-Medium-AcroMSung-Light-AcroSTSong-Light-AcroHeiseiKakuGo-W5-AcroHeiseiMin-W3-AcroHYGoThic-Medium-AcroHYSMyeongJo-Medium-AcroMSungStd-Light-AcroSTSongStd-Light-AcroHYSMyeongJoStd-Medium-AcroAdobeMingStd-Light-AcroAdobeSongStd-Light-AcroKozMinPro-Regular-AcroKozGoPro-Medium-AcroAdobeMyungjoStd-Medium-AcroKozMinProVI-RegularAdobeHeitiStd-RegularAUAG1AC1AJ1AK1AIGB1CNS1Japan1Korea1%s: CIDFont cache not initialized.../../../../texk/dvipdfmx/src/cid.c%s: CIDFont already have a parent Type1 font.%s: String can't be converted to REGISTRY-ORDERING-SUPPLEMENT: %s%s: Heighest supplement number supported in PDF-1.%d for %s-%s is %d.%s: Some character may not shown without embedded font (--> %s).%s: Incompatible CMap for CIDFont "%s"tmp && pdf_obj_typeof(tmp) == 6Inconsistent CMap used for CID-keyed font %s.CMap has higher supplement number than CIDFont: %sSome chracters may not be displayed or printed.tmp != ((void *)0) && pdf_obj_typeof(tmp) == 4<< /Subtype/CIDFontType0 /CIDSystemInfo << /Registry (Adobe) /Ordering (Japan1) /Supplement 2 >> /DW 1000 /W [ 231 632 500 8718 [500 500] ]>><< /CapHeight 709 /Ascent 723 /Descent -241 /StemV 69 /FontBBox [-170 -331 1024 903] /ItalicAngle 0 /Flags 6 /Style << /Panose <010502020300000000000000> >> >><< /Subtype/CIDFontType0 /CIDSystemInfo << /Registry (Adobe) /Ordering (Japan1) /Supplement 2 >> /DW 1000 /W [ 231 632 500 8718 [500 500] ]>><< /CapHeight 737 /Ascent 752 /Descent -271 /StemV 99 /FontBBox [-174 -268 1001 944] /ItalicAngle 0 /Flags 4 /Style << /Panose <0801020b0500000000000000> >> >><< /Subtype /CIDFontType0 /CIDSystemInfo << /Registry (Adobe) /Ordering (CNS1) /Supplement 0 >> /DW 1000 /W [13648 13742 500 17603 [500] ]>><< /Ascent 752 /CapHeight 737 /Descent -271 /StemV 58 /FontBBox [-45 -250 1015 887] /ItalicAngle 0 /Flags 4 /XHeight 553 /Style << /Panose <000001000600000000000000> >> >><< /Ascent 752 /CapHeight 737 /Descent -271 /StemV 58 /FontBBox [-160 -259 1015 888] /ItalicAngle 0 /Flags 6 /XHeight 553 /Style << /Panose <000000000400000000000000> >> >><< /Subtype /CIDFontType0 /CIDSystemInfo << /Registry (Adobe) /Ordering (GB1) /Supplement 2 >> /DW 1000 /W [ 814 939 500 7716 [500] 22355 [500 500] 22357 [500] ]>><< /Ascent 857 /CapHeight 857 /Descent -143 /StemV 91 /FontBBox [-250 -143 600 857] /ItalicAngle 0 /Flags 6 /XHeight 599 /Style << /Panose <000000000400000000000000> >> >><< /Subtype /CIDFontType0 /CIDSystemInfo << /Registry (Adobe) /Ordering (Japan1) /Supplement 2 >> /DW 1000 /W [ 231 632 500 8718 [500 500] ]>><< /Ascent 752 /CapHeight 737 /Descent -221 /StemV 114 /FontBBox [-92 -250 1010 922] /ItalicAngle 0 /Flags 4 /XHeight 553 /Style << /Panose <000001000500000000000000> >> >><< /Subtype /CIDFontType0 /CIDSystemInfo << /Registry (Adobe) /Ordering (Japan1) /Supplement 2 >> /DW 1000 /W [ 231 632 500 8718 [500 500] ]>><< /Ascent 723 /CapHeight 709 /Descent -241 /StemV 69 /FontBBox [-123 -257 1001 910] /ItalicAngle 0 /Flags 6 /XHeight 450 /Style << /Panose <000002020500000000000000> >> >><< /Subtype /CIDFontType0 /CIDSystemInfo << /Registry (Adobe) /Ordering (Korea1) /Supplement 1 >> /DW 1000 /W [ 97 [500] 8094 8190 500 ]>><< /Ascent 752 /CapHeight 737 /Descent -271 /StemV 58 /FontBBox [-6 -145 1003 880] /ItalicAngle 0 /Flags 4 /XHeight 553 /Style << /Panose <000001000600000000000000> >> >><< /Ascent 752 /CapHeight 737 /Descent -271 /StemV 58 /FontBBox [-0 -148 1001 880] /ItalicAngle 0 /Flags 6 /XHeight 553 /Style << /Panose <000000000600000000000000> >> >><< /Subtype /CIDFontType0 /CIDSystemInfo << /Registry (Adobe) /Ordering (CNS1) /Supplement 4 >> /DW 1000 /W [13648 13742 500 17603 [500] ]>><< /Ascent 880 /CapHeight 662 /Descent -120 /StemV 54 /FontBBox [-160 -249 1015 1071] /ItalicAngle 0 /Flags 6 /Style << /Panose <000000000400000000000000> >> >><< /Subtype /CIDFontType0 /CIDSystemInfo << /Registry (Adobe) /Ordering (GB1) /Supplement 4 >> /DW 1000 /W [ 814 939 500 7716 [500] 22355 [500 500] 22357 [500] ]>><< /Ascent 880 /CapHeight 626 /Descent -120 /StemV 44 /FontBBox [-134 -254 1001 905] /ItalicAngle 0 /Flags 6 /Style << /Panose <000000000400000000000000> >> >><< /Subtype /CIDFontType0 /CIDSystemInfo << /Registry (Adobe) /Ordering (Korea1) /Supplement 2 >> /DW 1000 /W [ 97 [500] 8094 8190 500 ]>><< /Ascent 880 /CapHeight 720 /Descent -120 /StemV 60 /FontBBox [-28 -148 1001 880] /ItalicAngle 0 /Flags 6 /Style << /Panose <000000000600000000000000> >> >><< /Subtype/CIDFontType0 /CIDSystemInfo << /Registry (Adobe) /Ordering (CNS1) /Supplement 4 >> /DW 1000 /W [13648 13742 500 17603 [500] ]>><< /Ascent 880 /Descent -120 /StemV 48 /CapHeight 731 /FontBBox [-38 -121 1002 918] /ItalicAngle 0 /Flags 6 /XHeight 466 /Style << /Panose <000002020300000000000000> >> >><< /Subtype/CIDFontType0 /CIDSystemInfo << /Registry (Adobe) /Ordering (GB1) /Supplement 4 >> /DW 1000 /W [ 814 939 500 7716 [500] 22355 [500 500] 22357 [500] ]>><< /Ascent 880 /Descent -120 /StemV 66 /CapHeight 626 /FontBBox [-134 -254 1001 905] /ItalicAngle 0 /Flags 6 /XHeight 416 /Style << /Panose <000002020300000000000000> >> >><< /Subtype/CIDFontType0 /CIDSystemInfo << /Registry (Adobe) /Ordering (Japan1) /Supplement 4 >> /DW 1000 /W [ 231 632 500 8718 [500 500] 9738 9757 250 9758 9778 333 12063 12087 500 ]>><< /Ascent 880 /Descent -120 /StemV 86 /CapHeight 740 /FontBBox [-195 -272 1110 1075] /ItalicAngle 0 /Flags 6 /XHeight 502 /Style << /Panose <000002020400000000000000> >> >><< /Subtype/CIDFontType0 /CIDSystemInfo << /Registry (Adobe) /Ordering(Japan1) /Supplement 4 >> /DW 1000 /W [ 231 632 500 8718 [500 500] 9738 9757 250 9758 9778 333 12063 12087 500 ]>><< /Ascent 880 /Descent -120 /StemV 99 /CapHeight 763 /FontBBox [-149 -374 1254 1008] /ItalicAngle 0 /Flags 4 /XHeight 549 /Style << /Panose <0000020b0700000000000000> >> >><< /Subtype/CIDFontType0 /CIDSystemInfo << /Registry (Adobe) /Ordering (Korea1) /Supplement 2 >> /DW 1000 /W [ 97 [500] 8094 8190 500 ]>><< /Ascent 880 /Descent -120 /StemV 99 /CapHeight 719 /FontBBox [-28 -148 1001 880] /ItalicAngle 0 /Flags 6 /XHeight 478 /Style << /Panose <000002020600000000000000> >> >><< /Subtype/CIDFontType0 /CIDSystemInfo << /Registry (Adobe) /Ordering (Japan1) /Supplement 6 >> /DW 1000 /W [ 231 632 500 8718 [500 500] 9738 9757 250 9758 9778 333 12063 12087 500 ] >><< /Ascent 880 /Descent -120 /StemV 86 /CapHeight 742 /FontBBox [-437 -340 1144 1317] /ItalicAngle 0 /Flags 6 /XHeight 503 /Style << /Panose <000002020400000000000000> >> >>U Y PZ U Z [ U $\ \ U $\ `] U ^ ^ V d_ _ V ` W BW FW JW NW uT QW UW ZW aW U BCzD\DCIDFont_type0_t1dofontZ v 0 K? v L) v v CIDFont_type0_t1openCIDFont_type0_t1copenCIDFont_type0_t1cdofontCIDFont_type0_openCIDFont_type0_dofont../../../../texk/dvipdfmx/src/cidtype2.cInvalid TTC index (not TTC font): %sReading TrueType table directory failed.Removed %d null character(s) from fontname --> %sRemoved string "%s" from fontname "%s".No valid character found in fontname string.CID character collection mismatched: Incompatible CMap specified for this font.Supplmement value in CIDSystemInfo increased.Some characters may not shown.Could not open TTF/dfont file: %sFound TrueType font file while expecting TTC file (%s).Could not read TrueType table directory (%s).No usable TrueType cmap table found for font "%s".CID character collection for this font is set to "%s-%s"Cannot continue without this...Could not find CID-to-Code mapping for "%s-%s".I tried to load (one of) the following file(s):Please check if this file exists.Unicode char U+%04x replaced with U+%04x.Glyph missing in font. (CID=%u, code=0x%04x)GSUB feature vrt2/vert not found.Could not created FontFile stream.Reading glyph metrics failed...Some required TrueType table (%s) does not exist.Could not created FontFile stream for "%s".font && opt-WIN-RKSJ-HCould not open TTF file: %sInvalid TTC index in %s.Not a TrueType/TTC font (%s)?Character set unknown. %s-%s-%sCannot continue...CID count > 65535vrt2*vert[%u glyphs (Max CID: %u)]FontFile2-WINP-RKSJ-H-WING-RKSJ-H-90pv-RKSJ-HUCSms-UCS4UCSms-UCS290ms-RKSJGBK-EUCETen-B5KSCms-UHC90pv-RKSJB5pcGBpc-EUCKSCpc-EUCheadhhealocamaxpglyffpgmcvt prepCIDFont_type2_open U b o  |   eb|   eb      ŀ ΀ u ؀ ݀     u       %"> & "" 0^Invalid CMap ID %dIdentity-HIdentity-Vcur && *curAmbiguous CMap entry.%s: Invalid CMap.CID number too large.cmap && dim > 0ucmapInvalid CIDSystemInfo.__cache(CMap:%s%s: Parsing CMap file failed. CMap name: %s input str: %s: Unknown mapping type.cmap && inbuf && outbufinbytesleft && outbytesleft%s: CMap cache not initialized.../../../../texk/dvipdfmx/src/cmap.c%s: Unrecognized profile type %d.cmap && cmap->mapData && size >= 0CIDSystemInfo mismatched %s <--> %s%s: CMap "%s" already defined.Invalid CMap mapping entry. (ignored)Trying to redefine already defined CID mapping. (ignored)Trying to redefine already defined code mapping. (ignored)Overlapping codespace found. (ingored)%s: Identical CMap object cannot be used for usecmap CMap: 0x%p=0x%p%s: CMap refering itself not allowed: CMap %s --> %s%s: CMap %s required by %s have different CSI.Cannot handle undefined mapping for this type of CMap mapping: %d<0000> is used for .notdef char.%s: Invalid/truncated input string.No mapping available for this character.%s: Premature end of input string.No character mapping available.Character mapped to .notdef found.%s: CharName mapping not supported.CMap_cache_findCMap_add_cidrangelocate_tblget_memCMap_add_bfrangeCMap_add_notdefrangeCMap_add_codespacerangeCMap_match_codespaceCMap_set_usecmapCMap_set_CIDSysInfoCMap_set_wmodeCMap_set_typeCMap_set_nameCMap_get_CIDSysInfoCMap_get_wmodeCMap_get_typeCMap_get_nameCMap_decodeCMap_get_profileCMap_is_IdentitymapDef_release../../../../texk/dvipdfmx/src/cmap_read.c%s: Mapping to charName not supported.%s: Invalid CMap mapping record. (ignored)%s: Invalid CMap mapping record.readerReading file failed.CMap_parse:endbfcharInvalid code range.endbfrangeendcidrangeendcidcharcmap && fpCMapNameCMapTypeWModebegin>>UIDOffsetusecmapbegincodespacerangeendcodespacerangebeginnotdefrangeendnotdefrangebeginnotdefcharendnotdefcharbeginbfrangebeginbfcharbegincidrangebegincidchar%!PSResource-CMapCMap_parseifreader_read%s: Unexpected error...%s: Unknown mapping type: %dUnexpected error....: %d%d beginbfchar endbfchar %d beginbfrange endbfrange Invalid CMapUseCMapUh ah. I cannot continue.../CMapName /%s def /CMapType %d def /WMode %d def %d begincodespacerange endcodespacerange UseCMap found (not supported yet).../CIDInit /ProcSet findresource begin 12 dict begin begincmap /CIDSystemInfo << /Registry (%s) /Ordering (%s) /Supplement %d >> def endcmap CMapName currentdict /CMap defineresource pop end end Type2 Charstring Parser%s: Unexpected error.%s: Possible buffer overflow.%s: Broken Type 2 charstring.%s: Operand stack not empty.%s: Garbage after endchar.%s: Subroutine called but no subroutine found.%s: Invalid Subr index: %ld (max=%u)%s: Argument value too large. (This is bug)%s: Subroutine nested too deeply.Operator "dotsection" deprecated in Type 2 charstring.%s: Charstring operator "random" found.%s: Unknown charstring operator: 0x0c%02x"seac" character deprecated in Type 2 charstring.%s: Unexpected call(g)subr/return%s: Unknown charstring operator: 0x%02x%s: Parsing charstring failed: (status=%d, stack=%d)?G7iUMu>@^^vvvvBB^jj ^vvvvBvv,)^)T0e m%s: %.2f %.2f (%.2fmm %.2fmm) ffffff9@R@letterlegalledgertabloida6a5a4a3b5varjisb6jisb5jisb4jisb3isob6isob5isob4isob3  @@'  @@-  @@4 @ @<  ףp=r@(\Nz@? (\Nz@\(@B \(@(\N@E (\N@q= ף@i v@zG@o zG@Ć@u Ć@ ףp=@{  ףp=@Ė@H zG@(\_@N v@zG@T zG@Ć@Z Ć@ ףp=@`  ףp=@Ė@f  v@0@l P@(@r (@P@x P@(@Filtering file via command -->%s<-- failed.File name="%s" format="%s" might be found in different location than I expected:>> Please adjust your TEXMF as conformant with:>> http://www.tug.org/ftp/tex/tds-1.1/tds.html#Fonts>> I searched it with fooling kpathsea as progname="%s" format="%s".>> Default search path for this format file is:File "%s" found but I could not open that...Found file "%s" for PostScript CMap but it doesn't look like a CMap...>> %s>> Please read "README" file.TMPDIR/tmprb%!PS-AdobeFont%!FontType1truettcfOTTOdvipdfmx.otf.encdvips.sfdttf2pk.icc.icm.dfontUnknown resource type: %dttf2tfm4 5EA?s*q D   DDummmmmmmmmmUU                      I    I               I                            I    Vh   z             7ht_iter_nextht_set_iterht_insert_tableht_remove_tableht_lookup_tableht_clear_tableht_init_tableUnknown escape char sequence: \%c../../../../texk/dvipdfmx/src/dpxutil.cht && ht->table && iterht && keyDVI stack exceeded limit.Unknown unit of measure: %sInvalid page number: %uReading DVI file failed!landscapepagesizexoffsetyoffsetpapersizeDVI ID = %d DVI need stack depth of %d,Capacity exceeded.DVI File Info Unit: %ld / %ld Magnification: %ld Media Height: %ld Media Width: %ld Stack Depth: %d Page count is 0!Page count: %4d DVI Comment: %s Unexpected op code: %3d DVI file font info size=%5.2fpt (scaled %4.1f%%)Tried to pop an empty stack.No font selected!<%s@%.2fpt(VF)>(OVF)>mmbpVirtual fonts nested too deeply!Unexpected opcode %d at pos=0x%xCould not open specified DVI file: %sFound %d where post_post opcode should be but DVI_STACK_DEPTH_MAX is %d.TeX Font: %10s loaded at ID=%5ld, Tried to pop an empty font stackCould not locate Omega Virtual Font "%s" for "%s".Could not locate a virtual/physical font for TFM "%s".>> This font is mapped to an intermediate 16-bit font "%s" with SFD charmap=<%s,%s>,>> but I couldn't find font mapping for "%s".>> and then mapped to a physical font "%s" by fontmap.>> Please check if kpathsea library can find this font: %s>> This font is mapped to a physical font "%s".>> There are no valid font mapping entry for this font.>> Font file name "%s" was assumed but failed to locate that font.Cannot proceed without .vf or "physical" font for PDF output...Tried to select a font that hasn't been defined: id=%ldSpecial more than %ul bytes???Tried to process non-existent page: %ldMultibyte (>16 bits) character not supported!Multibyte character (>16 bits) not supported!Got a bop in the middle of a page!DVI stack depth is not zero at end of pageUnexpected preamble or postamble in dvi fileUnexpected opcode or DVI file ended prematurely]e?bX<@jZ@?f 2?Y@Bn[H5n[H5n[H5n[H5n[H5n[H5n[H5n[H5n[H5%y0000001.1.1?10|112&2:2T2n22222223%3?3Y3s3333334494S4m4z4444k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0k0445'5>5U5l555555555k0k0k0k0k05 ;    Something is wrong. Are you sure this is a DVI file?Unrecognized paper format: %s20080607-l Landscape mode -q Be quiet -v Be verbose -vv Be more verbose 0x0001 reserved -S Enable PDF encryption Missing %s after "-%c". bitmap font dpimagnification valueannotation "grow" amounthorizontal offset valuevertical offset valueoutput file namepage selection specificationpaper format/sizefontmap file namePDF minor version numbercompression levelnumber of fractional digitsencryption key bitsencryption permission flagbookmark open levela numberInvalid flag: %sUnknown option in "%s"Multiple dvi filenames?.dviebbextractbbNo dvi filename specified.dvipdfmx.cfg.mps%s -> %s dvi_init() failed!%s.%d[%d<%s>No page output for "%s".[%dNo pages fall in range! Output file removed. {Gz?::':1:>:CDcBcBcBcBcBcBDcBmDcBDDcBcB2EcBcBEEcBcBcBcBcBcBcBcBcBcBcBcBEEF2FhFcBcBcBcBmIHcB#IFBFGHcBBcBB%C^C ;    Invalid paper size: %s (%.2fx%.2f) This is %s-%s by the DVIPDFMx project team, an extended version of dvipdfm-0.13.2c developed by Mark A. Wicks. Copyright (C) 2002-2008 by the DVIPDFMx project team This is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. Usage: dvipdfmx [options] dvifile -c Ignore color specials (for B&W printing) -d number Set PDF decimal digits (0-5) [2] -f filename Set font map file name [cid-x.map] -g dimension Annotation "grow" amount [0.0in] -m number Set additional magnification -o filename Set output file name [dvifile.pdf] -p papersize Set papersize [a4] -r resolution Set resolution (in DPI) for raster fonts [600] -s pages Select page ranges (-) -t Embed thumbnail images of PNG format [dvifile.1] -x dimension Set horizontal offset [1.0in] -y dimension Set vertical offset [1.0in] -z number Set zlib compression level (0-9) [9] -C number Specify miscellaneous option flags [0]: 0x0002 Use semi-transparent filling for tpic shading command, instead of opaque gray color. (requires PDF 1.4) 0x0004 Treat all CIDFont as fixed-pitch font. 0x0008 Do not replace duplicate fontmap entries. Positive values are always ORed with previously given flags. And negative values replace old values. -D template PS->PDF conversion command line template [none] -K number Encryption key bits [40] -O number Set maximum depth of open bookmark items [0] -P number Set permission flags for PDF encryption [0x003C] -V number Set PDF minor version [4] All dimensions entered on the command line are "true" TeX dimensions. Argument of "-s" lists physical page ranges separated by commas, e.g., "-s 1-3,5-6" Papersize is specified by paper format (e.g., "a4") or by w,h (e.g., "20cm,30cm"). PS->PDF conversion command line templateInvalid bitmap font dpi specified: %sInvalid magnification specifiied: %sBad page range specification: %sdvipdfm "-e" option not supported.PDF version 1.%d not supported. (1.4 used instead)Invalid encryption key bits specified: %sInvalid encryption permission flag: %sCould not open config file "%s".Invalid page number for MPS input: -1EncryptRootCan't read document catalog.MarkInfoMarkedPagesPage tree not found.Page %ld does not exist.ResourcesMediaBoxBleedBoxTrimBoxArtBoxCropBoxRotateKidsContentsXObjectFormFormTypeThis PDF document is encrypted.File contains tagged PDF. Ignoring tags.Page %ld not found! Broken PDF file?No BoundingBox information available.<< /Rotate %d >> found. (Not supported yet)Page content not a stream object. Broken PDF file?Could not handle content stream with multiple segment.Page content not a stream object.** WARNING ** ** ERROR ** ../../../../texk/dvipdfmx/src/fontmap.cbase == 0 || (base >= 2 && base <= 36)Invalid map record: %s (--> %s)Missing a number value for 's' option.Missing a number value for 'e' option.Invalid value for 'e' option: %sMissing a number value for 'b' option.Invalid value for 'b' option: %sMissing a number for 'p' option.Invalid value for option 'p': %sMissing string value for option 'u'.Missing a number for 'v' option.Invalid value for option 'm': %sInvalid value for option 'm': %s,Fontmap option 'w' meaningless for encoding other than "unicode".Invalid value for option 'w': %sUnrecognized font map option: '%c'Invalid char in fontmap line: %cMissing a PostScript font name.Couldn't open font map file "%s".Found a mismatched fontmap line %d from %s.-- Ignore the current input buffer: %sInvalid map record in fontmap line %d from %s.mrecdst && srcdefaultnoneUniUBigUBgUGBUKSUJISInvalid map record: %s.Missing TTC index number...Invalid TTC index number: %sInvalid value for option 'm'.sfd:Missing value for option 'm'.pad:Missing wmode value...SlantFontExtendFontFound an invalid entry: %sInvalid fontmap record...fontmap>> insert key="%s"... fontmap>> Expand @%s@:fontmap>> append key="%s"...fontmap>> remove key="%s"...filenamefontmapy ? < @ = F G H P R Q     S   ) -  %& #!0 t H.F G1 ?4 @7 >*) 2 3 5 4: =X ) 157 t ,Overflow in axbocFile ended prematurely ../../../../texk/dvipdfmx/src/otl_conf.cconfoptionrulelanguagescriptotl_conf_find_optotl_conf_get_ruleotl_conf_get_languageotl_conf_get_script../../../../texk/dvipdfmx/src/otl_opt.cSyntax error: %s Syntax error: Unbalanced () Invalid char in tag: %c otl_match_optruleotl_parse_optstringRGB GRAYcolorspaceProfile size: %ldacspcolor1 && color2SaturationPerceptualAbsoluteColorimetricRelativeColorimetriccdataicchascpscnrmntrprtrspacpdf_color>> ICC Profile Info CMM Typepdf_color>> %s: (null) pdf_color>> %s: (invalid) pdf_color>> %s: %c%c%c%c Device ClassColor SpaceConnection Spacepdf_color>> Creation Date: %04u:%02uPrimary PlatformDevice MnfctDevice Modelpdf_color>> Device Attr: :%02xAbsolute ColorimetricRelative Colorimetric(invalid)Creator%.3f %.3f %.3f pdf_color>> Checksum: (null)pdf_color>> Calculated: (ColorSpace:%s[ICCBased][CalRGB][CalGray]ICC profile not embedded.(ICCP:[id=%d])ICCBasedInvalid color value: %g!!pdf_flush_colorspacerelease_iccbased_cdataget_num_components_iccbasediccp_init_iccHeader init_iccbased_cdatacompare_iccbasedprint_iccp_headerpdf_init_colorspace_structpdf_color_is_whitepdf_color_copycolorpdf_color_graycolorpdf_color_cmykcolorpdf_color_rgbcolor../../../../texk/dvipdfmx/src/pdfcolor.c((cdata) && (cdata)->sig == (('i')<<24|('c')<<16|('c')<<8|('b')))Invalid color value specified: gray=%gInvalid color value specified: cyan=%gInvalid color value specified: magenta=%gInvalid color value specified: yellow=%gInvalid color value specified: black=%gInvalid color value specified: red=%gInvalid color value specified: green=%gInvalid color value specified: blue=%gICC Profile size: %ld(header) != %ldInvalid ICC profile: not "acsp" - %c%c%c%c Reserved pad not zero: %02x (at offset %ld in ICC profile header.)You've mistakenly made a global color change within nested colors.Invalid rendering intent type: %d((cdata1) && (cdata1)->sig == (('i')<<24|('c')<<16|('c')<<8|('b')))((cdata2) && (cdata2)->sig == (('i')<<24|('c')<<16|('c')<<8|('b')))pdf_color>> Profile Size: %ld bytes pdf_color>> Profile Version: %d.%01d.%01d pdf_color>> Profile Flags: %02x:%02x:%02x:%02x pdf_color>> Rendering Intent: pdf_color>> Illuminant (XYZ): Invalid ICC profile header in "%s"File size smaller than recorded in header: %ld %ldICC profile format spec. version %d.%01d.%01d not supported in current PDF version setting.Unsupported ICC Profile Device Class:Unsupported input color space.Loading ICC Profile failed...: %sInvalid ICC profile: Inconsistent checksum.Color stack underflow. Just ignore.Color stack overflow. Just ignore.Only RGB/CMYK/Gray currently supported.%.*f>]TJ)]TJ ET BT /%s DoUnknown device parameter: %dfontmap: %s -> %s[extend:%g][slant:%g][bold:%g][noemb][map:<%02x>][csi:%s][index:%d][style:bold][style:italic][style:bolditalic]Unbalenced q/Q nesting...: %dInvalid font: %d (%d) /%s 2 Tr %.2f wToo long string... Td[< Td[(Buffer overflow...MbP?@@@Too thin line: height=%ld (%g bp)Please consider using "-d" option.Too thin line: width=%ld (%g bp)pdf_dev_locate_font() called with the zero ptsize.Ignore color option was set. Just ignore.No valid color is specified. Just ignore.Number of decimal digits out of range [0-%d].../../../../texk/dvipdfmx/src/pdfdev.cCMap conversion failed. (%d bytes remains)Error in converting input string...??{Gz?MbP?-C6?h㈵>ư>Hz>:0yE>& .> d'@Bʚ;dev_set_font@FStTextImageCImageBImageIProcSetEmpty bookmark node!TitleJavaScriptJSPage number %ul too large!Invalid Page number %ul.Annotation: [%g %g %g %g]Rect@THISPAGE@PREVPAGE@NEXTPAGEReference to "%s" not exist. NamesCatalogp && dictnode->dictFirstParentPrevNextLastPageAnnots"%s" removed from DocInfo.%s (%s)ProducerCreationDateThreadsOutlinesViewerPreferencesPageLabelsNumsCould not modify PageLabels..pdfcurrentpage%s.%ldThumbIgnoring...AuthorSubjectKeywordsModDateDestsAPTemplatesIDSURLSEmbeddedFilesAlternatePresentationsRenditionsTried to close a nonexistent form XOject.Can't go up above the bookmark root node!You have tried to jump more than 1 level.app.alert("The author of this document made this bookmark item empty!", 3, 0)Annotation out of page boundary.Current page's MediaBox: [%g %g %g %g]Maybe incorrect paper size specified.Rectangle with negative width/height: [%g %g %g %g]../../../../texk/dvipdfmx/src/pdfdoc.cReference to previous page, but no pages have been completed yet.Document dict. "%s" not exist. Page with empty content found!!!Nonexistent page #%ld refered.Entry for a nonexistent page #%ld created.Annotation attached to a nonexistent page #%ld.Article beads attached to a nonexistent page #%ld."%s" in DocInfo dictionary not string type.D:%04d%02d%02d%02d%02d%02d%c%02ld'%02ld'Could not modify Names dictionary.Could not modify ViewerPreferences.No article identifier specified.Specified article thread that doesn't exist.Article thread without internal identifier.A pending form XObject at the end of page.Could not open thumbnail file "%s"Thumbnail "%s" not a png/jpeg file!Could not read thumbnail file "%s".Unknown name dictionary category "%s".Passed non indirect reference...Conflicting page resource found (page: %ld, category: %s, name: %s).flush_bookmarksa    a r {  " ( g 4 + 5 9 > L c doc_fill_page_backgroundpdf_doc_get_referencepdf_doc_get_dictionarypdf_doc_bookmarks_addHz>:0yE>9RFߑ?../../../../texk/dvipdfmx/src/pdfdraw.cr && ( (opchr) == 'f' || (opchr) == 'F' || (opchr) == 's' || (opchr) == 'S' || (opchr) == 'b' || (opchr) == 'B' || (opchr) == 'W' )Transformation matrix not invertible.Inverting matrix with zero determinant...pa && ( (opchr) == 'f' || (opchr) == 'F' || (opchr) == 's' || (opchr) == 'S' || (opchr) == 'b' || (opchr) == 'B' || (opchr) == 'W' )Closing pending transformations at end of page/XObject.GS stack depth is not zero at the end of the document.stack n [] d--- M = [%g %g %g %g %g %g]pa && M %d i %d j %d Jdepth >= 0 QToo many grestores.gs1 && gs2 qvcurvetoycurvetoFzVzzzz)zpdf_dev__rectshapem_stack_toppdf_dev_itransformpdf_dev_transformpdf_dev_idtransformpdf_dev_dtransformpdf_path__clearpathm! l) c1 v y h  pdf_dev__flushpathpdf_dev_concatpdf_path__transformpdf_dev_currentmatrixpdf_dev_currentpointpdf_dev_grestore_tom_stack_popclear_a_pathm_stack_pushcopy_a_gstatepdf_invertmatrixCB@Reading CMap file "%s" failed.Failed to creat ToUnicode CMap stream for "%s".../../../../texk/dvipdfmx/src/pdfencoding.cIllegal base encoding %s for encoding %s (CMap:%s)enc_name && enc_vecInvalid encoding id: %dencodingWinAnsiEncodingMacRomanEncodingMacExpertEncodingenc_name(Encoding:%s!encoding->resourceBaseEncodingDifferences!encoding->tounicodeEuronotequalinfinitylessequalgreaterequalpartialdiffsummationproductintegralOmegaradicalapproxequalDeltalozengeapplepdf_create_ToUnicode_CMappdf_encoding_findresourcepdf_init_encoding_structpdf_encoding_completeStandardLengthOwner password: Re-enter owner password: User password: Re-enter user password: %04d%02d%02d%02d%02d%02dInvalid revision number. Password is not identical. Try again. %s-%s, Copyright 2002 by Jin-Hwan Cho and Shunsaku Hirata(N^NuAdNV..h>/ dSiz../../../../texk/dvipdfmx/src/pdffont.cpdf_font>> Object not flushed.Only 16-bit encoding supported for output encoding.pdf_font>> Input encoding "%s" requires at least 2 bytes. pdf_font>> The -m <00> option will be assumed for "%s". Failed to read UCS2/UCS4 TrueType cmap...Could not find encoding file "%s". pdf_font>> Type0 font "%s" (cmap_id=%d) found at font_id=%d. pdf_font>> Simple font "%s" (enc_id=%d) found at id=%d. font_cache.fonts == ((void *)0)Failed to read ToUnicode mapping "%s"...Object returned by pdf_load_ToUnicode_stream() not stream object! (This must be bug)pdf_font>> ToUnicode CMap "%s" attached to font id="%s". Invalid font ID: %dpdf_font> Object not flushed.font && fontnameType3TrueType.cmap pdf_font>> Type0 font "%s" cmap_id=<%s,%d> opened at font_id=<%s,%d>. Unknown font type: %d pdf_font>> Simple font "%s"builtin enc_id=<%s,%d>(%s[%s+%s][built-in]font->map_nameToUnicode[Type1][Type1C][TrueType][Type3/PK]Undefined in fontname... (%s)%6s+%sжжpж/I@pdf_font_set_flagspdf_font_set_subtypepdf_font_set_fontnamepdf_font_get_uniqueTagpdf_font_get_parampdf_font_get_flagspdf_font_get_flagpdf_font_get_encodingpdf_font_get_usedcharspdf_font_get_descriptorpdf_font_get_resourcepdf_font_get_fontnamepdf_font_get_mapnamepdf_font_get_identpdf_font_get_indexpdf_font_is_in_usepdf_init_font_structtry_load_ToUnicode_CMappdf_init_fontsLimitsInvalid object...: %sht_tabReplacing with null.names && objectnames && *names../../../../texk/dvipdfmx/src/pdfnames.cNamed object "%s" not defined!!!Tried to release nonexistent reference: %sTrying to close object @%s twice?Object @%s not defined or already closed.Invalid type: @%s is not reference...Object reference "%s" is in use.Please close it before redefining.Null string used for name tree key.Object reference with key "%s" is in use.Unresolved object reference "%s" found!!!flat_tablepdf_names_close_objectpdf_names_lookup_objectpdf_names_lookup_referencepdf_names_add_referencepdf_names_add_objectpdf_delete_name_treeNot indirect reference...procInvalid object type: %d%PDF-1.pdf_files%03o%lu %hu obj endobj Didn't find "obj".endobjDidn't find "endobj".%ld ObjStm{%d}falseFlateDecodeZlib error stream endstream!indirect->pf%lu %hu R<< Encrypt object already set!Info object already set!Root object already set!1.2.3inflateInit() failed.Invalid type.DecodeParmsBroken PDF file?SizeIndexGarbage in xref stream.startxreftrailer%lu %lu%010lu %05u %cbuffer: ->%s<- XRefStmError while parsing PDF file.Cannot parse object stream.Can't resolve object: %lu %uCould not read object: %lu %u%d %lu %010lu %05hu %c trailer startxref %%EOF %ld bytes writtenXRefwbUnable to open "%s".Unable to open file.% typecheck: Invalid object type: %d %d (line %d)pdf_link_obj(): passed invalid object.pdf_label_obj(): passed invalid object.set_compression: invalid compression level: %d../../../../texk/dvipdfmx/src/pdfobj.cVersion of PDF file (1.%c) is newer than version limit specification.Unknown cross-reference stream entry type.pdfobj_escape_str: Buffer overflow pdf_release_obj: object=%p, type=%d, refcount=%d pdf_release_obj: Called with invalid object.pdf_put_dict(): Passed invalid key.pdf_add_dict(): Passed invalid value.pdf_add_dict(): Passed invalid valuepdf_write_obj: Invalid object, type = %d PDF array element #ld undefined.pdf_ref_obj(): passed invalid object. Trying to refer already released object!!! inflate() failed. Broken PDF file?Streams with DecodeParams not supported.DecodeFilter "%s" not supported.Multiple DecodeFilter not supported.Cannot parse cross-reference stream.pdf_open: Not a PDF 1.[1-5] file.Premature end of PDF file while parsing xref table.Invalid xref table entry [%lu]. PDF file is corrupt...No trailer. Are you sure this is a PDF file?Skipping hybrid reference section.Trying to read nonexistent or deleted object: %lu %uCould not read object from object stream.Tried to deref a non-file objectobject type %hu not allowed in xref table. Try "-V 5" for better compressionCompression saved %ld bytes%s 5%T4F%t0Oy ubRB2"pdf_files_closepdf_openpdf_file_get_trailerpdf_file_newwrite_indirectpdf_lookup_dictpdf_foreach_dictPremature end of input hex string.PDF string length too long. (limit: %ld)Unbalanced parens/truncated PDF literal string.Could not find a string object.Invalid char in PDF name object. (ignored)Null char not allowed in PDF name object. (ignored)PDF name length too long. (>= %d bytes)PDF name length too long. (>= %d bytes, truncated)Could not find a numeric object.Number with more than %d fractional digits.Could not find any valid object.Could not find the named reference (@%s).Could not find a reference name.Could not find an array object.Could not find a valid object in array object.Array object ended prematurely.Could not find a key in dictionary object.Could not find a value in dictionary object.Syntax error: Dictionary object ended prematurely.!"#$&'*+,-./0123456789:;?@ABCDEFGHIJKLMNOPQRSTUVWXYZ\^_`abcdefghijklmnopqrstuvwxyz|~!"#$&'*+,-.0123456789:;=?@ABCDEFGHIJKLMNOPQRSTUVWXYZ\^_`abcdefghijklmnopqrstuvwxyz|~Not a null object.Not a boolean object.Could not find a name object.No valid name object found. Current input buffer is --><-- endstreaUnknown PDF object type.j1:1:12:122h2-2-2-2-2-2-2-2-2-2-2:1:12:1:1:11:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:11:1:1:1:1:1:1:1:1:1:1~1:1:1:1:1:1:1:11:1:1:1:1:1~1??{Gz?MbP?-C6?h㈵>ư>Hz>:0yE>& .>|=|  Invalid category ID: %dInvalid resource ID: %dObject already flushed???Undefined object...resname && categoryUnknown resource category: %scategory && objectresShadingPatternExtGState../../../../texk/dvipdfmx/src/pdfresource.cResource %s (category: %s) already defined...Trying to release un-flushed object.pdf_findresourceET BT jk  77 ' / 7 pdf_resource_existpdf_defineresourcepdf_init_resourceInvalid XObject ID: %dImage width=0.0!Image height=0.0!ImageBitsPerComponentIm%dFm%dUnknown XObject subtype: %dError opening image file "%s"(Image:%s%![MPS]Try again with the distiller.[JPEG][PNG][BMP][PDF],Page:%ld[PS][UNKNOWN]pdf_image>> %s pdf_image>> ...>> Please check ifImage XObject must be of stream type.Error locating image file "%s"No image converter available for converting file "%s" to PDF format.>> Please check if you have 'D' option in config file.Failed to create temporary file for image conversion: %spdf_image>> Converting file "%s" --> "%s" via: Image format conversion for "%s" failed...Could not open conversion result "%s" for image "%s". Why?pdf_image>> deleting file "%s"Failed to include image file "%s">> %%o = output filename, %%i = input filename, %%b = input filename without suffix>> can really convert "%s" to PDF format image.pdf: image inclusion failed for "%s".Invalid DPI: %d 0 %ld %ld %ld %ld d1 q %ld 0 0 %ld %ld %ld cm x%02XCharProcsWidthsFirstCharLastCharEOD reached while unpacking pk_packed_num.DESGIN_SIZE <= 0.0? (TFM="%s")../../../../texk/dvipdfmx/src/pkfont.cident && usedchars && point_size > 0.0Could not find/open PK font file: %s (at %udpi)Unable to handle long characters in PK files: code=0x%04xError in reading PK character header.More than two bitmap image for single glyph?: font="%s" code=0x%02xOnly %ld bytes PK packet read. (expected %ld bytes)BI /W %ld /H %ld /IM true /BPC 1 ID run_color != 0 for bitmap pk data?Insufficient bitmap pk data. %ldbytes expected but only %ldbytes read.Second repeat count for this row!Unpacking PK character data failed.".notdef" glyph used in font (code=0x%02x): %sembed_pk_font: PK ID byte is incorrect. Are you sure this is a PK file?Missing glyph code=0x%02x in PK font "%s".Unexpected error: firstchar > lastchar (%d %d)PK font is found for font "%s" but non built-in encoding "%s" is specified.>> Assuming this is for glyph name assignment.GI?wgggggYY hpdf_font_load_pkfont@ Unusual Gamma specified: %gWhitePointGamma%s: Unusual Gamma value: %gCalRGBCalGrayXObjcect1.2.29%s: Unknown PNG colortype %d.SMask%s: PNG does not have valid tRNS chunk!%s: You found a bug in pngimage.c.Non invertible matrix: Maybe invalid value(s) specified in cHRM chunk.%s: Invalid cHRM chunk parameters found.%s: Inconsistent rowbytes value.You found a bug in pngimage.c!%s: Creating Libpng read/info struct failed.%s: Transparency will be ignored. (no support in PDF ver. < 1.3)%s: Please use -V 3 option to enable binary transparency support.%s: Please use -V 4 option to enable full alpha channel support.%s: Invalid value in PNG sRGB chunk: %d%s: PNG does not have valid PLTE chunk.%s: PNG does not have valid tRNS chunk but tRNS is requested.Unexpected error in png_include_image().|۽|=j@T*J%@ІZІ../../../../texk/dvipdfmx/src/pst.c*inbuf <= inbufend && !*inbufendUnexpected end of ASCII hex string marker.pst_get_tokenASCII85 string not supported yet.Invalid char for hex string <%x> treated as <0>.Premature end of input name string.Invalid char for name object. (ignored)String too long for name object. Output will be truncated.Input string too long for name object. String will be truncated.../../../../texk/dvipdfmx/src/pst_obj.cOperation not defined for this type of object.Cound not convert string to real value.Cannot convert object of type UNKNOWN to integer value.Cannot convert object of type UNKNOWN to real value.Unrecognized object type: %d%.5gƟ;˟0;Ǡ lMҢ9lq¤aUqǦҦǧߧ Tpst_data_ptrpst_boolean_data_ptrpst_integer_data_ptrpst_real_data_ptrpst_name_data_ptrpst_string_data_ptrpst_getSVpst_boolean_SVpst_integer_SVpst_real_SVpst_string_SVpst_getRVpst_boolean_RVpst_integer_RVpst_real_RVpst_string_RVpst_getIVpst_boolean_IVpst_integer_IVpst_real_IVpst_length_ofpst_name_lengthpst_string_lengthpst_type_ofpst_release_objpst_boolean_releasepst_integer_releasepst_real_releasepst_name_releasepst_string_releaseS? ../../../../texk/dvipdfmx/src/sfnt.cFont file not opened or already closed...sfont && sfont->directoryLength1sfont && tagsfnt: table not found...sfont && sfont->streamInvalid index %d for dfont.sfnt_create_FontFile_streamsfnt_require_tablesfnt_read_table_directorysfnt_locate_tablesfnt_find_table_possfnt_find_table_lensfnt_set_tabledfont_opensfnt_openbackgroundsph && spe && appushNot color/background special?../../../../texk/dvipdfmx/src/spc_color.cspc_color_setup_handler../../../../texk/dvipdfmx/src/spc_dvips.cNo corresponding ::[begin] found.Interpreting PS code failed!!! Output might be broken!!!Stack not empty after execution of inline PostScript code.>> Your macro package makes some assumption on internal behaviour of DVI drivers.>> It may not compatible with dvipdfmx.ps:plotfile found (not properly implemented)Expecting filename but not found...No filename specified for PSfile special.handle && spe && argsNot ps: special???ps::[begin]:[end]Could not open PS file: %sFailed to read image file: %sPSfilepsfileps: plotfilePS: plotfilePS:" pp00(,0spc_dvips_setup_handlerspc_handler_ps_defaultspc_handler_ps_literalspc_handler_ps_plotfilespc_handler_ps_file../../../../texk/dvipdfmx/src/spc_html.cUnclosed html anchor at end-of-page!...html anchor continues from previous page processed...html "img" tag found (not completed, plese don't use!)."src" attribute not found for "img" tag!Error in html "img" tag attribute.Sorry, you can't have both "href" and "name" in anchor tag...Failed to add named destination: %sYou should have "href" or "name" in anchor tag!Closing html anchor (link) without starting!No corresponding opening tag for html anchor."href" not found for "base" tag!"baseurl" changed: "%s" --> "%s"html:Unclosed html anchor found.Invalid length value: %s (%c)svg:opacityInvalid opacity value: %ssvg:transformmatrixCould not find/load image: %s_Tps_a%03d_ /Nested html anchors found!hrefsd->link_dict == ((void *)0)AnnotLinkDestActionURIpage_refXYZEmpty html anchor tag???Close tag for "base"???imgClose tag for "img"???pxskewXskewYBA:`4spc_html_setup_handlerhtml_open_linkhtml_open_dest ;    ] /1g ../../../../texk/dvipdfmx/src/spc_misc.cNo width/height/filename given for postscriptbox special.Syntax error in postscriptbox special????:{%lfpt}{%lfpt}{%255[^}]}Image file "%s" not found.Could not open image file: %sFailed to load image file: %spostscriptboxsrc:pos:om:Xp% H fkpspc_misc_setup_handlerspc_handler_postscriptboxpdf:Not pdf: special???No fontmap file specified.Empty mapline special?Invalid fontmap line.Name tree key must be string.Could not open file: %sParsing dictionary failed.reversedirectGBKKSCNo object identifier given.Couldn't start form object.pdf_obj_typeof(kp) == 4cd && cd->taintkeyspdf_obj_typeof(vp) == 3tk && pdf_obj_typeof(tk) == 4No valid color specified?Invalid color specification?Missing object identifier.resourceskp && vp && dpError in reading dictionary.Ignoring invalid dictionary.annotationannotateoutlinearticleartbeadthreaddestinationdestdocinfodocviewputclosebopeopimageepdfnolinkbegincolorsetcolorscolorendcolorecolorbegingraybgrayendgrayegraybgcolorbgcbbcbbgbannotbeginannbanneannotendanneannbtransbegintransformbegintransbtetransendtransformendtransbformbeginxobjbxobjeformendxobjusexobjuxobjliteralfstreammaplinemapfilebcontentecontentSubjTUTM../../../../texk/dvipdfmx/src/spc_pdfm.cInvalid fontmap line: Missing TFM name.PDF name expected but not found.PDF object expected but not found.Array size not multiple of 2 for pdf:names.Failed to add Name tree entry...Invalid object type for pdf:names.PDF string expected for destination name but not found.PDF string expected for destination name but invalid type.No destination not specified for pdf:dest.Destination not specified as an array object!Missing objname for pdf:(f)stream.Missing input string for pdf:(f)stream.Invalid type of input string for pdf:(f)stream.Missing filename for pdf:fstream.Could not find a object identifier.Could not find an object definition for "%s".The special "pdf:literal reverse ..." is no longer supported. Ignore the "reverse" option.Missing CMap name for pdf:tounicode.Missing ToUnicode mapping name...Failed to load ToUnicode mapping: %sSpecified (image) object doesn't exist: %sA form XObject must have name.Bounding box has a zero dimension.Tried to end an annotation without starting one!Can't begin an annotation when one is pending.Ignoring annotation with invalid dictionary.Invalid type: not a dictionary object.Failed to convert input string to UTF16...Object reference name for image "%s" already used.Missing filename string for pdf:image.Ignore invalid attribute dictionary.Could not find image resource...Specified object not exist: %sMissing (an) object(s) to put into "%s"!Inconsistent object type for "put" (expecting DICT): %s"put" operation not supported for STREAM <- STREAM: %sInvalid type: expecting a DICT or STREAM: %sCan't "put" object into non-DICT/STREAM/ARRAY type object: %sInvalid type (not DICT) for page/form resource dict entry: key="%s"Object "%s" already defined in dict! (ignored)Dictionary object expected but not found.Article name expected but not found.Ignoring article with invalid info dictionary.Article identifier expected but not found.Article reference expected but not found.You can't specify both bbox and width/height.Missing number for outline item depth.Expecting number for outline item depth.Could not find dictionary object.Invalid type: not dictionary object.Unbalanced bann and eann found.    0 SZ0      ,z `[ `1 9 ~ Ap E K O S { Y ` ^ e p@y@. @00 000 0/ P000 0"6u +1;A`G`Q`O0W0b ]0z@e  mu }0spc_pdfm_setup_handlermodstringsneedreencodesafeputresdictsafeputresdenta    a r  ../../../../texk/dvipdfmx/src/spc_tpic.cUnflushed tpic path at end of the document.Unflushed tpic path at end of the page.TPIC command "tx" not supported.Too few points (< 2) for polyline path.Tpic shading support requires PDF version 1.4.Transparent fill mode requires PDF version 1.4.Invalid value for TPIC option fill-mode...Invalid value for TPIC option fill-mode: %sUnrecognized option for TPIC special handler: %sMissing numbers for TPIC "pa" command.Invalid arg for TPIC "pa" command.Too few points (< 3) for spline path.Invalid args. in TPIC "ar" command.Invalid arg for TPIC "ar" command.Invalid args. in TPIC "ia" command.Invalid arg for TPIC "ia" command.spe && ap && tptpic:__setopt__ 0 GAIS /%s gs %.2f gkp && vp && tpfill-modeshapesolidInvalid pen size specified?pnpadtwhbk;On?cܥL@.P% .&  P!   v ' .(  ) ? , 3. &E p .P .  spc_tpic_setup_handlerspc_handler_tpic_txspc_handler_tpic_bkspc_handler_tpic_whspc_handler_tpic_shspc_handler_tpic_iaspc_handler_tpic_arspc_handler_tpic_spspc_handler_tpic_dtspc_handler_tpic_daspc_handler_tpic_ipspc_handler_tpic_fpspc_handler_tpic_paspc_handler_tpic_pntpic_filter_getoptsti && spe && args!page_nohoffsetcolorspec && spe && aprgbcmykhsbUnrecognized color name: %svoffsethsizevsizehscalevscaleanglellxllyurxuryrwirhixscaleyscalebboxhideGreenYellowGoldenrodDandelionApricotPeachMelonYellowOrangeBurntOrangeBittersweetRedOrangeMahoganyMaroonBrickRedOrangeRedRubineRedWildStrawberrySalmonCarnationPinkMagentaVioletRedRhodamineMulberryRedVioletFuchsiaLavenderThistleDarkOrchidPlumRoyalPurpleBlueVioletPeriwinkleCadetBlueCornflowerBlueMidnightBlueNavyBlueRoyalBlueCeruleanCyanProcessBlueSkyBlueTurquoiseTealBlueAquamarineBlueGreenEmeraldJungleGreenSeaGreenForestGreenPineGreenLimeGreenYellowGreenSpringGreenOliveGreenRawSiennaSepiaBrownTanWhite A@2 2 2 2 2 = &= K= s= = = U< ; < < < < *< ; 76 8 8 8 Z9 : f: ; 6 9 : Z: D D D D D D D spc_util_read_dimtrns01"1(1.151<1 B1F1J1N1R1V1܅/1Z1a1g h1 9m1 ;    spc_util_read_colorspecrgb_color_from_hsv../../../../texk/dvipdfmx/src/spc_util.cUnrecognized dimension/transformation key: %sSyntax error in dimension/transformation specification.Missing value for dimension/transformation: %sUnrecognized key or invalid value for dimension/transformation: %sCan't supply both width and xscale. Ignore xscale.Can't supply both height/depth and yscale. Ignore yscale.Can't supply overall scale along with axis scales.Can't supply transform matrix along with scales or rotate. Ignore scales and rotate.Invalid value for RGB color specification.Invalid value for CMYK color specification.Invalid value for gray color specification.Invalid value for HSB color specification.HSB color converted to RGB: hsb: <%g, %g, %g> ==> rgb: <%g, %g, %g>Unbalanced '[' and ']' in color specification.../../../../texk/dvipdfmx/src/specials.cInterpreting special command %s (%s) failed.>> at page="%ld" position="(%g, %g)" (in PDF)>> Reading special command stopped around >>%s<<Unparsed material at end of special ignored.Object reference %s not exist.\x%02x>> xxx "%s"!named_objectsxpostpicunknownyposthispageprevpagenextpagepagescatalogL M M M M M M hM MM 2M (O O O O O O P P 'P 8P   0@`@ е 9!  p  @  =P0p9spc_handler_unknownspc_exec_at_begin_document999999 91spc_lookup_objectspc_lookup_referenceInvalid subfont_id: %dcurpos >= 0 && curpos <= 255 at id="%d" subfont>> %04xPossible buffer overflow in reading SFD file (buffer full, size=%d bytes) subfont>> Scanning SFD file "%s"... subfont>> id="%s" at line="%d" subfont>> %d entries found in SFD file "%s". Subfont id="%s" not exist in SFD file "%s"... subfont>> Loading SFD mapping table for <%s,%s>...Unknown token in subfont mapping table: %cInvalud value for subfont table offset: %ldInvalid value in subfont mapping table: 0x%x_0x%xInvalid char in subfont mapping table: %cInvalid character code in subfont mapping table: 0x%xInvalid range in subfont mapping: curpos="0x%02x" range="0x%04x,0x%04x"Subfont mapping for slot="0x%02x" already defined...../../../../texk/dvipdfmx/src/subfont.cError occured while reading SFD file: file="%s" subfont_id="%s"Failed to load subfont mapping table for SFD="%s" subfont_id="%s" subfont>> Content of mapping table:read_sfd_recordTFM: Invalid TFM ID: %dInvalid char: %ld Invalid TFM header.Can't proceed...Proceeding nervously....tfm.ofmUnable to find TFM file "%s".(TFM:%s(OFM:%sOFM level %d not supported.TFM file error: ec(%u) < bc(%u) ???TFM file size is expected to be %ld bytes but it says it is %ld bytes!Could not open specified TFM/OFM file "%s".TFM/OFM file too small to be a valid file.OFM file error: ec(%u) < bc(%u) ???I may be interpreting a font direction incorrectly.OFM file problem. Table sizes don't agree.Can't handle OFM files with level > 1Repeats causes number of characters to be exceeded.Invalid TTC index numberfont file not opened licensed font ** XHeightAvgWidthPanoseStylettc_read_offset(): invalid font type ** NOTICE: This document contains `Preview & Print' only *** Embedding disabled due to licensing restriction *** BHBUnrecognized TrueType cmap format.../../../../texk/dvipdfmx/src/tt_cmap.cFour bytes charcode not supported in TrueType cmap format 0...6.Unrecognized TrueType cmap subtable formatNo OTL feature matches "%s.%s.%s" found.No GSUB featre %s.%s.%s loaded...Invalid Unicode code specified.otf_cmap>> Ligature component:Unicode char U+%04X not exist in font...Unicode char U+%06X not exist in font...otf_cmap>> Ligature glyph gid=%u assigned to U+%04X otf_cmap>> Ligature glyph gid=%u assigned to U+%06X Font does not have glyph for U+%04X.Font does not have glyph for U+%06X.No substituted glyph for U+%04X.No substituted glyph for U+%06X.otf_cmap>> Substituted glyph gid=%u assigned to U+%04X otf_cmap>> Substituted glyph gid=%u assigned to U+%06X Number of glyphs in left-side and right-side not equal...No Unicode mapping available: GID=%uotf_cmap>> Additional ToUnicode mapping: <%04X> <Unrecognized cmap subtable format.Could not open OpenType/TrueType/dfont font file "%s"Not a OpenType/TrueType/TTC font?: %sCould not read OpenType/TrueType table directory.No glyph contained in this font...Unknown CFF charset format...: %dotf_cmap>> Unicode charmap for font="%s" layout="%s" otf_cmap>> Found at cmap_id=%d. Unable to read OpenType/TrueType Unicode cmap table.GID %u does not have corresponding CID %u.Failed to read OpenType/TrueType cmap table.otf_cmap>> Read layout config. "%s" otf_cmap>> Layout option "%s" enabled There are no option "%s" in "%s".Glyph gid=%u does not have corresponding CID.otf_cmap>> Overwrite CMap "%s" by "%s" with usecmap otf_cmap>> Creating ToUnicode CMap for "%s"... Could not open TrueType font file "%s"Could not read TrueType table directory.Format 12 cmap table ... untested    /          ۃ 0 ۃ  ۃ  ۃ ۃ ۃ ۃ ۃ  Ι      `       add_glyphfind_glyphcreate_cmapstt_cmap_lookuptt_cmap_readNot arraytype?otf_cmap>> %s: assignInvalid Unicode in: %04XInvalid Unicode in: %06X U+%04X (gid=%u) U+%06X (gid=%u)Missing glyph found...No ligature found...substitutePlease check .otl file...CMap conversion failed...invalid cmap subtableUCS-4 TrueType cmap table...Invalid TTC index%s,%03d-UCS4-V%s,%03d-UCS4-H%s,%03d,%s-UCS4-V%s,%03d,%s-UCS4-HCould not open CFF font...No CIDSystemInfo???No CFF charset data???%s,%03d-UTF16Layout file "%s" not found...cmap && unencoded../../../../texk/dvipdfmx/src/tt_glyf.cInvalid TrueType glyph data (gid %u).Invalid TrueType glyph data (gid %u): %u bytesInvalid gid (%u > %u) in composite glyph %u.No empty glyph slot available.File not opened.Invalid font typeUnknown metricDataFormat.Unknown IndexToLocFormat.Invalid glyph index (gid %u)Slot %u already used.Too many glyphs.tt_get_metricstt_build_tablestt_add_glyphtt_get_indextt_find_glyph../../../../texk/dvipdfmx/src/tt_gsub.cUnknown format for single substitutionUnknown GSUB SubstFormat for Ligature: %uUnknown GSUB SubstFormat for Alternate: %uotl_gsub>> Reading "%s.%s.%s"... otl_gsub>> OTL script-language enabled: %c%c%c%c.dflt otl_gsub>> OTL script-language enabled: %c%c%c%c.%c%c%c%c otl_gsub>> Reading OTL feature(s):Skipping unsupported GSUB subtable: LookupType=%dReading GSUB subtable (single) failed...Reading GSUB subtable (alternate) failed...Reading GSUB subtable (ligature) failed...Reading GSUB subtable (ext:single) failed...Reading GSUB subtable (ext:ligature) failed...otl_gsub>> %ld subtable(s) read. covUnknown coverage formatGSUB not selected...subtab && gid_outsubtab && gidlist && sfontcov && sfontrec && sfontsubtab && sfontunexpected SubstFormatToo many GSUB features...gsub && sfontGSUBdflt____ %c%c%c%cunrecognized FeatureParamsinvalid Lookup index.(single)(alternate)(ligature)(ext:single)(ext:ligature)otl_gsub>> Failed otl_gsub_apply_ligatureclt_lookup_coverageotl_gsub_apply_alternateotl_gsub_apply_singleotl_gsub_read_featclt_read_langsys_tableclt_read_record_listclt_read_recordclt_read_number_listotl_gsub_read_singleclt_read_coverageclt_read_rangeotl_gsub_read_alternateotl_gsub_read_ligature../../../../texk/dvipdfmx/src/tt_post.cTrueType 'post' version 2.5 found (deprecated)TrueTypes post table name index %u > 32767Invalid glyph name index number: %u (>= %u)Invalid TrueType 'post' table...postpost && glyphnameUnknown 'post' version: %08X.nullnonmarkingreturnnonbreakingspacefrancGbrevegbreveIdotaccentScedillascedillaCacutecacuteCcaronccarondcroattt_release_post_tablett_lookup_post_tableZTTTc/ < < < = Y/ > = = *= 3= 8= >= E= > rYع L= P= V= [= `= d=  B> n= j= t=  y= u/  +57 t /> .LOW  0 = l )    ? T/ = > > > )? ? ? N? ? ? q > > z d?   = K?    ?  > >   ? ? ~/ j/ @?  =   .> > > T@ @ @ > &? Y>  C !> > =  = ?  A @ =  > <> J> oC sC g> q> > > > ? (@ ? 4@ >@ E@ L@ X@ b@ p@ w@  @ @ @ @ ? ? @ ?/ TT @ @ 2/ F/  U> ? @ A @ A ? X? ? @ A n? ? h? ? 4? ? ? \? t? ? TTTTTTTUUUUExpecting zeroUnsupported VORG version.unknown metricDaraFormatpassed NULL pointer ** Notice: Name string too long. Truncating ** ** Warning: No valid PostScript name available ** No glyphs actually used???suffix && gm && outsuffix && *suffix != 0Not found...U+%06lXU+%04lXUh ah...ligadlighligfracccmpafrc[%d glyphs][glyphs:/.notdef/.c0x%02xidentpdf_obj_typeof(tmp) == 6 trutype>> Try loading OTL GSUB for "*.*.%s"...../../../../texk/dvipdfmx/src/truetype.cglyphs && n_glyphs > 0 && gm && gid(?lig|lig?|?cmp|cmp?|frac|afrc)Variant "%s" for glyph "%s" might not be found.Using glyph name without suffix instead...Glyph "%s" looks like a composite glyph...>> Composite glyph glyph-name="%s" found at glyph-id="%u".>> Input Unicode seq.="%s" ==> glyph-id="%u" in font-file="_please_try_-v_".font && encoding && usedchars && sfontNo post table nor Unicode cmap found in font: %s>> I can't find glyphs without this!Character code="0x%02X" mapped to ".notdef" glyph used in font font-file="%s">> Maybe incorrect encoding specified?Could not resolve glyph "%s" (%dth component of glyph "%s").Glyph "%s" not available in font "%s".truetype>> Glyph glyph-name="%s" found at glyph-id="%u". Packing TrueType font into SFNT file faild...Unable to open TrueType/dfont font file: %sUnable to open TrueType/dfont file: %sFont "%s" not a TrueType/dfont font?Reading SFND table dir failed for font-file="%s"... Not a TrueType font?Could not read Mac-Roman TrueType cmap table...Glyph for character code=0x%02x missing in font font-file="%s".Packing TrueType font into SFNT failed!Error occured while creating font subfont for "%s"Required TrueType table "%s" does not exist in font: %sCould not open TrueType font: %sCustom encoding not allowed for non-embedded TrueType font.Font file="%s" can't be embedded due to liscence restrictions.Can't find valid fontname for "%s".u ؀ ݀     u    q do_custom_encodingcomposeglyphselectglyphresolve_glyphfindparanoiacpdf_font_open_truetypecmap_nameAdobe-Identity-UCS2 100 beginbfrange <%02X00> <%02XFF> <%02X00> endbfrange 48 beginbfrange %s-%s-UTF16%s-%s-UCS2(CID:%s)Unrecognized CIDFont TypeDescendantFonts../../../../texk/dvipdfmx/src/type0.c%!PS-Adobe-3.0 Resource-CMap %%DocumentNeededResources: ProcSet (CIDInit) %%IncludeResource: ProcSet (CIDInit) %%BeginResource: CMap (Adobe-Identity-UCS2) %%Title: (Adobe-Identity-UCS2 Adobe UCS2 0) %%Version: 1.0 %%Copyright: %% --- %%EndComments /CIDInit /ProcSet findresource begin 12 dict begin begincmap /CIDSystemInfo 3 dict dup begin /Registry (Adobe) def /Ordering (UCS2) def /Supplement 0 def end def /CMapName /Adobe-Identity-UCS2 def /CMapVersion 1.0 def /CMapType 2 def 2 begincodespacerange <0000> endcodespacerange endcmap CMapName currentdict /CMap defineresource pop end end %%EndResource %%EOF %s: No descendant CID-keyed font.Failed to load ToUnicode CMap for font "%s"%s: FontDescriptor unexpected for Type0 font.pdf_read_ToUnicode_fileType0Font_init_font_structType0Font_get_resourceType0Font_get_usedcharsType0Font_get_encodingType0Font_get_wmodeType0Font_set_ToUnicode../../../../texk/dvipdfmx/src/t1_char.cUnexpected Type 2 charstring command %d.Garbage after endchar. (%ld bytes)Unknown Type 2 charstring command: %dObsolete four arguments of "endchar" will be used for Type 1 "seac" operator.cdargn <= 48Subroutine nested too deeply.Invalid Subr#.Too many hints...Unknown othersubr #%ld.Unexpected callsubr.Stack not empty. (%d, %d)Charstring encoder error: %dstem_idx < cd->num_stemsPGPB PB PB PB PB A mB 5C C D PB PB PB PB PB PB PB PB PB PB PB B E E PB PB PB PB PB PB PB E EG PB PB PB H MM U U O O O T T O O O O gT O O O S RS O O O O O O O O O O O O O O O T M R M R Q R Q Q gR lQ ?S MM M )R R M M M M M M 7Q Q M M M M M M M Q Q X [ +[ dW V V V V V V V V tW W Ce d d d d @h @h @h @h @h d d d d d d d d d d d f @h @h d @h @h d d d d @h @h d d h h h add_stemadd_charpatht1char_encode_charpathrelease_charpathNot a pfb file?PFB segment length zero?No .notdef glyph???RD-|readstringND|-Parsing Subrs failed.arrayduplenIVStandardEncodingISOLatin1EncodingExpertEncoding not supported.readonlyFontType %d not supported.UnderLinePositionUnderLineThicknessNot a PFB font file?Reading PFB (ASCII part) file failed.FontName "%s" too long. (%d bytes)%d values expected but only %d read.FontName too long: %s (%d bytes)Reading PFB (BINARY part) file failed.Ambiguous PostScript resource type: %sZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZTc/ < < < = Y/  = = = *= 3= 8= >= E= > rYع L= P= V= [= `= d=  B> n= j= t=  y= u/  +57 t /> .LOW  0 = l )     > > !> .> <> J> oC sC ZY> `> g> q> Z> > > > > > > > Z~/ Z@ ? ? @ ?/ TT? Z @ @ Z2/ F/  U C ZZZZZZZZZZZZZZZZ> Z> ZZZZ> > > > ZZZZZ ? ZZZ? ZZ? ? &? )? ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZTc/ < < < = Y/ > = = *= 3= 8= >= E= > rYع L= P= V= [= `= d=  B> n= j= t=  y= u/  +57 t /> .LOW  0 = l )    = ? > ? ? > .> @? >= ? ?/ ? d? ? ? ? K? > q> @ 4? > > t? \? ? ~/ @ ? ? @ ?  @ > @ >@ !@ (@ 4@ b@ E@ L@ X@ X? i@ @ p@ w@ @ @ ? > @ @ @ @ @ n? )? @ @ @ A @ A  ? A 5A A A +A YA uHuWuiuuuuuuu../../../../texk/dvipdfmx/src/type1c.cOnly embedded font supported for CFF/OpenType font.Could not open OpenType font: %sCould not read OpenType table directory: %sCharstring too long: gid=%u, %ld bytesMaybe incorrect encoding specified.No "CFF " table found. Not a CFF/OpenType font?No valid FontName found in CFF/OpenType font.Built-in encoding used for CFF/OpenType font.CFF font in OpenType font sometimes have strange built-in encoding.If you find text is not encoded properly in the generated PDF file,please specify appropriate ".enc" file in your fontmap.Could not obtain neccesary font info from OpenType table.Unexpected error....No glyphs used at all!Could not read CFF font datapdf_font_load_type1cpdf_font_open_type1cPremature end of DVI byte stream in VF font Premature end of DVI byte stream in VF font.Tried to set a nonexistent character in a virtual fontMultibyte (>16 bits) character in VF packet. I can't handle this!Long character (>16 bits) in VF file. I can't handle long characters! Warning:Font_id: %ld not found in VF char=0x%lx(%ld) Unexpected opcode: %d Unexpected opcode in vf file vf_set_char: font: %dFont not loaded VF file ended prematurely.(VF:%sVF file may be corrupt char=%ld Quitting on code=%d F 2 J J Z   J J [ o         6 E \ s         5 L c u                                                                         7 M c y                  Version 0.2 -v Verbose .xbb.bbWriting to %s: Bounding box: %d %d %d %d %%%%Title: %s %%%%Creator: %s %s %%%%BoundingBox: %d %d %d %d %%%%CreationDate: %s .jpeg.JPEG.jpg.JPG.PDF.png.PNG%s, version %s, Copyright (C) 2008 by Jin-Hwan Cho A bounding box extraction utility from PDF, PNG, and JPG. Usage: %s [-v] [-b] [-m|-x] [files] -b Write output file in binary mode -m Output .bb file used in DVIPDFM -x Output .xbb file used in DVIPDFMx (default) Warning: %s: Filename does not end in a recognizeable extension. Unable to open output file: %s Can't find file (%s)...skipping %s does not look like a JPEG file... Catalog isn't where I expect it.%s does not look like a PDF file... Can't handle file type for file named %s %s does not look like a PNG file... JFIF%      ]     p                                            O Q8? F%u? libpng version 1.2.29 - May 8, 2008 Copyright (c) 1998-2008 Glenn Randers-Pehrson Copyright (c) 1996-1997 Andreas Dilger Copyright (c) 1995-1996 Guy Eric Schalnat, Group 42, Inc. libpng version 1.2.29 - May 8, 2008 Unknown freer parameter in png_data_freer.Potential overflow in png_zalloc()Too many bytes for PNG signature.%d %s %d %02d:%02d:%02d +00001.2.29PNG  "U3UJanFebMarAprMayJunJulAugSepOctNovDecInvalid bit depthInvalid color typeInvalid image widthInvalid image heightWidth too large for libpng to process image data.Too many IDAT's foundNot enough image dataExtra compressed dataDecompression errorNot a PNG fileMissing IHDR before IDATMissing PLTE before IDATzlib memoryzlib versionUnknown zlib error1.0.6 or earlierzlib memory errorzlib version errorInvalid attempt to read row dataIgnoring extra png_read_update_info() call; row buffer not reallocatedPNG file corrupted by ASCII conversionImage is too high to process with png_read_png()Application uses deprecated png_read_init() and should be recompiled.Application was compiled with png.h from libpng-%.20sApplication is running with png.c from libpng-%.20sThe png struct allocated by the application for reading is too small.The info struct allocated by application for reading is too small.Incompatible libpng version in application and library  , \ H o  It's an error to set both read_data_fn and write_data_fn in the same structure. Resetting write_data_fn to NULL.Read ErrorCall to NULL read function?ư>o@@;C|^ Sf f |^ ~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?@P `0pDT$d4tHX(h8x L\,l<|AQ!a1qEU%e5u IY)i9y M]-m=}BR"b2rFV&f6v JZ*j:zN^.n>~CS#c3sGW'g7w K[+k;{O_/o? 0@P`p!1AQaq"2BRbr#3CScs$4DTdt%5EUeu&6FVfv'7GWgw(8HXhx )9IYiy *:JZjz +;K[k{ ,N^n~/?O_oOut of memory while processing unknown chunk.tRNS chunk has out-of-range samples for bit_depthInvalid palette size, hIST allocation skipped.Insufficient memory for hIST chunk data.Setting negative gamma to zeroIgnoring attempt to set all-zero chromaticity valuesIgnoring attempt to set negative chromaticity valueIgnoring attempt to set chromaticity value exceeding 21474.83Out of memory while processing sPLT chunkInsufficient memory to process iCCP chunk.Insufficient memory to process iCCP profile.Insufficient memory for pCAL purpose.Insufficient memory for pCAL units.Insufficient memory for pCAL params.Insufficient memory for pCAL parameter.Insufficient memory to store textImage width or height is zero in IHDRimage size exceeds user limits in IHDRWidth is too large for libpng to process pixelsInvalid color type/bit depth combination in IHDRUnknown interlace method in IHDRUnknown compression method in IHDRMNG features are not allowed in a PNG datastreamSetting gamma=0Limiting gamma to 21474.83No memory for sPLT palettes.iTXt chunk not supported.Invalid image size in IHDRInvalid bit depth in IHDRInvalid color type in IHDRUnknown filter method in IHDRInvalid filter method in IHDRInvalid palette lengthQ@0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfa deflate 1.2.3 Copyright 1995-2005 Jean-loup Gailly ' # #  #              L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c            (08@P`p   0@`  0@`need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible version  '2?J^k incorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setinvalid literal/length codeinvalid distance codeinvalid distance too far backincorrect data checkincorrect length checktoo many length or distance symbolsg Z V W W X X mY  Z Z F[ u[ ^ f c \ ]  e ud &` ` a Hb i b c h h c      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O inflate 1.2.3 Copyright 1995-2005 Mark Adler @@ !1Aa  0@` #+3;CScsprogname && kpse_program_nameprognamecompile-time paths.htexmf.cnfprogram config file environment variableapplication override variablegfTEXFONTSGLYPHFONTSGFFONTS$KPATHSEA_DPI--dpi$MAKETEX_MAG--mag$MAKETEX_BASE_DPI--bdpi$MAKETEX_MODE--mfmodemktexpkTEXPKSPKFONTSbitmap font.:/nonesuch/texmf/fontsmktextfmTFMFONTSAFMFONTS.afmmktexfmtTEXMFINIMFBASES.baseTEXBIBBIBINPUTS.bibBSTINPUTS.bstTEXMFCNFls-RTEXMFDBSls-rTEXFORMATS.fmtTEXFONTMAPSMPMEMS.memmktexmfMFINPUTS.mfMFTINPUTS.:/nonesuch/texmf/mft//.mftmfpoolMFPOOL${TEXPOOL}.poolMPINPUTS.:/nonesuch/texmf/metapost//.mpmppoolMPPOOLMetaPost supportMPSUPPORTmkocpOCPINPUTS.:/nonesuch/texmf/omega/ocp//.ocpmkofmOFMFONTSOPLFONTS.oplOTPINPUTS.:/nonesuch/texmf/omega/otp//.otpOVFFONTS.ovfOVPFONTS.ovpgraphic/figureTEXINPUTSTEXPICTS.epsi.epsmktextex.tex.ldf.clo.def.bbl.aux.fd.cls.styPostScript headerTEXPSHEADERS.proTeX system documentationTEXDOCStexpoolTEXPOOL.:/nonesuch/texmf/web2cTeX system sourcesTEXSOURCES.:/nonesuch/texmf/source//.ins.dtxTroff fontsTRFONTStype1 fontsT1INPUTST1FONTS.pfb.pfa.:/nonesuch/texmf/fonts/vf//.vfdvips config/nonesuch/texmf/dvips//TEXINDEXSTYLE.:/nonesuch/texmf/makeindex//.isttruetype fontsTTFONTS.TTC.TTF.ttc.ttftype42 fontsT42FONTS.T42.t42web2c filesWEB2Cother text files$TEXMF/other binary filesmisc fontsMISCFONTS.:/nonesuch/texmf/web//.web.chcwebCWEBINPUTS.:/nonesuch/texmf/cweb//.wenc filesENCFONTS.:/nonesuch/texmf/fonts/enc//cmap filesCMAPFONTSsubfont definition filesSFDFONTS.:/nonesuch/texmf/fonts/sfd//opentype fontsOPENTYPEFONTSpdftex configPDFTEXCONFIGlig filesLIGFONTS.:/nonesuch/texmf/fonts/lig//.ligtexmfscriptsTEXMFSCRIPTSLUAINPUTS.texlua.luatex.lua.texluc.luctex.luc%s: fatal: kdebug: = %s before expansion = %s (none) texmf.cnf path = %s compile-time path = %s environment variables = %s default suffixes = (none) other suffixes = numeric format value = %d program enabled = %d program enable level = %d try_std_extension_first%s file `%s' not foundTEXSIZESwarning: ../../../texk/kpathsea/tex-file.c.:/nonesuch/texmf/fonts/gf/$MAKETEX_MODE//.:{/nonesuch/texmf/fonts,/nonesuch/vartexfonts}/pk/{$MAKETEX_MODE,modeless}//.:{/nonesuch/texmf/fonts,/nonesuch/vartexfonts}/tfm//.:/nonesuch/texmf/fonts/afm//:$OSFONTDIR//.:/nonesuch/texmf/web2c{/$engine,}.:/nonesuch/texmf/bibtex/bib//.:/nonesuch/texmf/bibtex/{bst,csf}//{$SELFAUTOLOC,$SELFAUTODIR,$SELFAUTOPARENT}{,{/share,}/texmf{-local,}/web2c}{!!/nonesuch/texmfsysconfig,!!/nonesuch/texmfsysvar,!!/nonesuch/texmfmain,!!/nonesuch/texmflocal,!!/nonesuch/texmfdist,!!/nonesuch/texmfDOC}.:/nonesuch/texmf/fonts/map/{$progname,pdftex,dvips,}//.:/nonesuch/texmf/metafont//:{/nonesuch/texmf/fonts,/nonesuch/vartexfonts}/source//.:/nonesuch/texmf/metapost/support.:{/nonesuch/texmf/fonts,/nonesuch/vartexfonts}/{ofm,tfm}//.:{/nonesuch/texmf/fonts,/nonesuch/vartexfonts}/opl//.:{/nonesuch/texmf/fonts,/nonesuch/vartexfonts}/{ovf,vf}//.:{/nonesuch/texmf/fonts,/nonesuch/vartexfonts}/ovp//.:/nonesuch/texmf/tex/{$progname,generic,}//.:/nonesuch/texmf/{dvips,fonts/{enc,type1,type42,type3}}//.:/nonesuch/texmf/doc{/man,}//:/nonesuch/texmfdocdir///usr{/local,}/share/groff/{current/font,site-font}/devps.:/nonesuch/texmf/fonts/type1//:$OSFONTDIR//.:/nonesuch/texmf/fonts/truetype//:$OSFONTDIR//.:/nonesuch/texmf/fonts/type42//.:/nonesuch/texmf/fonts/misc//.:/nonesuch/texmf/fonts/cmap//.:/nonesuch/texmf/fonts/opentype//:$OSFONTDIR//.:/nonesuch/texmf/pdftex/{$progname,}///nonesuch/texmf/scripts/{$engine,$progname,}//.:/nonesuch/texmf/scripts/{$progname,$engine,}/lua//:$TEXINPUTSkpse_init_format: Unknown format %dSearch path for %s files (from %s) application override path = %s application config file path = %s search only with suffix = %d runtime generation program = %s runtime generation command =kpse_find_file: searching for %s of type %s (from %s) kpathsea: last resort size %s not in ascending order, ignored Ί   d ߍ   n ׏  /  L ђ L     | /  (  ? Ҙ   }  { ͛  # k    f  Π 2  U Ѣ ,  , t  9 kpse_reset_program_namekpse_find_file_generic%s: Last line ends with \KPATHSEA_WARNING../../../texk/kpathsea/cnf.ckpathsea: configuration file texmf.cnf not found in these directories: %skpse_cnf_getdb:match(%s,%s) = %d ls-R hash table:aliases%s: %u aliases. alias hash table:kpathsea: No usable entries in %skpathsea: See the manual for how to generate ls-R%s: %u entries in %d directories (%d hidden). fclose(0x%lx) => %d fopen(%s, %s) => 0x%lx %s: Unmatched {KPSE_DOT@cincludetexfonts.map%s:%u: Filename argument for include directive missing%s:%u: Can't find fontname include file `%s'%s:%u: Fontname alias missing for filename `%s'%4d :%-5d %s=>%shash_lookup(%s) => (nil) %u buckets, %u nonempty (%u%%); %u entries, average chain %.1f. ../../../texk/kpathsea/kdefault.cfallbackkpse_expand_defaultTEXMFLOG%lu %s start search(files=[%ssearch([%s]) =>search(%s) =>], must_exist=%d, find_all=%d, path=%s). start search(file=%s, must_exist=%d, find_all=%d, path=%s). MAKEPKKPATHSEA_DEBUGPATHlstat(%s) failed ... /..SELFAUTOLOCSELFAUTODIRSELFAUTOPARENTexereadableKPATHSEA_FORMATKPATHSEA_NAME$KPATHSEA_NAME.$KPATHSEA_DPI$KPATHSEA_FORMATdpi$KPATHSEA_DPI/$KPATHSEA_NAME.$KPATHSEA_FORMATTEX_HUSHkpathsea: Invalid fontname `%s', starts with '%c' kpathsea: Invalid fontname `%s', contains '%c' ../../../texk/kpathsea/tex-make.ckpathsea: open("/dev/null", O_RDONLY)kpathsea: open("/dev/null", O_WRONLY)kpathsea: %s output `%s' instead of a filenamekpathsea: Appending font creation commands to %s. dpi != 0 && bdpi != 0%u+%u/%u%u+%u/(%u*%u+%u)%u+%u/(%u*%u)%u+%u/(4000+%u)magstep\(%s%d.%d\) kpathsea: Running/dev/nullkpathsea: pipe()kpathsea: fork()kpathsea: read()MISSFONT_LOGmissfont.logTEXMFOUTPUTset_maketex_mag../../../texk/kpathsea/tilde.c!!HOMEkpse_tilde_expand%s: No matching } for ${(nil)variable: %s = %s kpathsea: variable `%s' references itself (eventually)%s: Unrecognized variable construct `$%c'../../../texk/kpathsea/variable.ckpse_var_value../../../texk/kpathsea/xfopen.cfilename && modexfclosexfopengetcwd: %sfatal: memory exhausted (xmalloc of %u bytes). putenv(%s)fatal: memory exhausted (realloc of %u bytes). path element %s =>kpse_normalize_path (%s) => %u ../../../texk/kpathsea/elt-dirs.c((elt[elt_length - 1]) == '/') || 0do_subdir../../../texk/kpathsea/fn.c((*f).length) > loc((*f).str) != ((void *)0)fn_shrink_tofn_freet?ǘ@333333?closedir faileddir_links(%s) => %ld I  - Hȉ؃ B `8(oȍoo >N^n~Αޑ.>N^n~Βޒ.>N^n~Γޓ.>N^n~Δޔ.>N^n~Εޕ.>N^n~U U U uT QCR?;?R@@X<(R@R@?@P@??ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZTc/ < < < = Y/ > = = *= 3= 8= >= E= > rYع L= P= V= [= `= d=  B> n= j= t=  y= u/  +57 t /> .LOW  0 = l )    l > > = > > `> g> ? > @ <> > > @ > > =  = !> > > Y>  C @ N? A J> &? > A @ Tj/ T/ =  > = ? > ? ? > .> @? >= ? ?/ ? d? ? ? ? K? > q> @ 4? > > t? \? ? ~/ @ ? ? @ ?  @ > @ >@ !@ (@ 4@ b@ E@ L@ X@ X? i@ @ p@ w@ @ @ ? > @ @ @ @ @ n? )? @ @ @ A @ A  ? A 5A A A +A YA  = = *= 3= 8= >= E= > rYع L= P= V= [= `= d=  B> n= j= t=  y= u/  +57 t /> .LOW  0 = l )    ? T/ = > > > )? ? ? N? ? ? q > > z d?   = K?    ?  > >   ? ? ~/ j/ @?  =   .> > > T@ @ @ > &? Y>  C !> > =  = ?  A @ =  > <> J> oC sC g> q> > > > ? (@ ? 4@ >@ E@ L@ X@ b@ p@ w@  @ @ @ @ ? ? @ ?/ TT @ @ 2/ F/  UZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZTA A D A B B  B +B =B PB _B 8= >= E= = nB {B B B B B B B B B n= j= ZB Z!C ZZZZG ZZt? \? ? mE wE E E E E ZZZZZZ oC sC nC rC vC ZC C )E C C C C C G C C C C C D  D D D  D 'D .D 5D